Welcome to !

>EG11496 PrfH Pseudogene, protein release factor homolog
VLETETGRYSDTLRSALVSLDGDNAWALSESWCGTIQWICPSPYRPHHGRKNWFLGIGRFTADEQEQSDAIRYET
LRSSGPGGQHVNKTDSAVRATHLASGISVKVQSERSQHANKRLARLLIAWKLEQQQQENSAALKSQRRMFHHQIE
RGNPRRTFTGMAFIEG 




Copyright 2006 University of Miami.
PHP-Nuke Copyright © 2005 by Francisco Burzi. This is free software, and you may redistribute it under the GPL. PHP-Nuke comes with absolutely no warranty, for details, see the license.
Page Generation: 0.01 Seconds