Blast performed on October-5-2014
BLASTP 2.2.24+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: uniref100
           37,618,376 sequences; 13,713,897,232 total letters



Query=  EG10269 envZ 
Length=450
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  UniRef100_P0AEJ4 Osmolarity sensor protein EnvZ n=426 Tax=Enter...   921    0.0   
  UniRef100_H4Y7C6 EnvZ n=1 Tax=Escherichia coli DEC7D RepID=H4Y7...   920    0.0   
  UniRef100_E7SI46 Osmolarity sensory histidine kinase EnvZ n=1 T...   920    0.0   
  UniRef100_C8TJJ4 Sensory histidine kinase EnvZ in two-component...   920    0.0   
  UniRef100_UPI0003A51852 osmolarity sensor protein n=1 Tax=Esche...   920    0.0   
  UniRef100_B2U3L2 Osmolarity sensor protein EnvZ n=1 Tax=Shigell...   920    0.0   
  UniRef100_G1YF88 Osmolarity sensor protein envZ n=2 Tax=Escheri...   919    0.0   
  UniRef100_C3SC37 Protein histidine kinase/phosphatase EnvZ n=14...   919    0.0   
  UniRef100_B7NE09 Sensory histidine kinase in two-component regu...   919    0.0   
  UniRef100_M8RXE9 Osmolarity sensor protein envZ n=7 Tax=Escheri...   919    0.0   
  UniRef100_E1HMZ5 Osmolarity sensor protein EnvZ n=2 Tax=Escheri...   918    0.0   
  UniRef100_B7L4T4 Sensory histidine kinase in two-component regu...   918    0.0   
  UniRef100_U5M4A7 Sensory histidine kinase in two-component regu...   918    0.0   
  UniRef100_UPI0003A16341 osmolarity sensor protein n=1 Tax=Esche...   918    0.0   
  UniRef100_UPI00039F9BB0 osmolarity sensor protein n=1 Tax=Esche...   918    0.0   
  UniRef100_N2Y4W4 Osmolarity sensor protein envZ n=2 Tax=Escheri...   918    0.0   
  UniRef100_N2VQX0 Osmolarity sensor protein envZ n=1 Tax=Escheri...   918    0.0   
  UniRef100_M8Z6S0 Osmolarity sensor protein envZ n=2 Tax=Escheri...   918    0.0   
  UniRef100_B7LSA7 Sensory histidine kinase in two-component regu...   918    0.0   
  UniRef100_L3PZG6 Osmolarity sensor protein envZ n=1 Tax=Escheri...   917    0.0   
  UniRef100_B7M1W0 Sensory histidine kinase in two-component regu...   917    0.0   
  UniRef100_UPI0003EF1246 osmolarity sensor protein n=1 Tax=Esche...   917    0.0   
  UniRef100_C6UG04 Osmolarity sensor protein n=2 Tax=Escherichia ...   917    0.0   
  UniRef100_T6MJ56 Osmolarity sensor protein envZ n=1 Tax=Escheri...   917    0.0   
  UniRef100_F4M535 Osmolarity sensor protein EnvZ n=2 Tax=Escheri...   917    0.0   
  UniRef100_N3F4G2 Osmolarity sensor protein envZ n=1 Tax=Escheri...   917    0.0   
  UniRef100_A1AGT0 Osmolarity sensor protein EnvZ n=306 Tax=Esche...   917    0.0   
  UniRef100_W0AVU2 Osmolarity sensory histidine kinase EnvZ n=3 T...   917    0.0   
  UniRef100_E2QFQ4 Osmolarity sensor protein envZ n=94 Tax=Escher...   917    0.0   
  UniRef100_UPI0003A6F712 osmolarity sensor protein n=1 Tax=Esche...   916    0.0   
  UniRef100_M8LFP3 Osmolarity sensor protein envZ n=7 Tax=Escheri...   916    0.0   
  UniRef100_UPI0003EF8771 osmolarity sensor protein n=1 Tax=Esche...   916    0.0   
  UniRef100_T9SMR3 Osmolarity sensor protein envZ n=1 Tax=Escheri...   916    0.0   
  UniRef100_N2DN61 Osmolarity sensor protein envZ n=1 Tax=Escheri...   916    0.0   
  UniRef100_B7NMG9 Sensory histidine kinase in two-component regu...   915    0.0   
  UniRef100_T5P009 Osmolarity sensor protein envZ n=1 Tax=Escheri...   915    0.0   
  UniRef100_T7MV56 Osmolarity sensor protein envZ n=1 Tax=Escheri...   915    0.0   
  UniRef100_Q0P6L5 EnvZ variant n=1 Tax=Escherichia coli RepID=Q0...   915    0.0   
  UniRef100_V1D369 Osmolarity sensor protein EnvZ n=1 Tax=Escheri...   915    0.0   
  UniRef100_V8SE45 Osmolarity sensor protein envZ n=1 Tax=Escheri...   914    0.0   
  UniRef100_T8UGZ5 Osmolarity sensor protein envZ n=1 Tax=Escheri...   914    0.0   
  UniRef100_D8A6U3 Osmolarity sensor protein EnvZ n=2 Tax=Escheri...   914    0.0   
  UniRef100_UPI0003EE67A6 osmolarity sensor protein n=1 Tax=Esche...   914    0.0   
  UniRef100_N3YQW8 Osmolarity sensor protein envZ n=1 Tax=Escheri...   914    0.0   
  UniRef100_N4BZF3 Osmolarity sensor protein envZ n=1 Tax=Escheri...   913    0.0   
  UniRef100_E6NZX6 Osmolarity sensor protein envZ n=111 Tax=Enter...   913    0.0   
  UniRef100_N3LLU7 Osmolarity sensor protein envZ n=1 Tax=Escheri...   913    0.0   
  UniRef100_N4PT12 Osmolarity sensor protein envZ n=1 Tax=Escheri...   913    0.0   
  UniRef100_L2VK96 Osmolarity sensor protein envZ n=4 Tax=Escheri...   912    0.0   
  UniRef100_I6FK69 Osmolarity sensor protein envZ n=1 Tax=Shigell...   912    0.0   
  UniRef100_E7HHD5 Osmolarity sensor protein envZ n=6 Tax=Escheri...   912    0.0   
  UniRef100_N3N319 Osmolarity sensor protein envZ n=1 Tax=Escheri...   912    0.0   
  UniRef100_G1YVU0 Osmolarity sensor protein envZ n=2 Tax=Escheri...   912    0.0   
  UniRef100_F3WNU9 Osmolarity sensor protein envZ n=1 Tax=Shigell...   912    0.0   
  UniRef100_M8X1E5 Osmolarity sensor protein envZ n=1 Tax=Escheri...   912    0.0   
  UniRef100_M8R8L6 Osmolarity sensor protein envZ n=6 Tax=Escheri...   912    0.0   
  UniRef100_H4MEL9 EnvZ n=71 Tax=Escherichia coli RepID=H4MEL9_ECOLX   911    0.0   
  UniRef100_UPI0003619FE4 osmolarity sensor protein n=1 Tax=Esche...   911    0.0   
  UniRef100_H5Q553 EnvZ n=4 Tax=Escherichia coli RepID=H5Q553_ECOLX    911    0.0   
  UniRef100_M8QNB3 Osmolarity sensor protein envZ n=1 Tax=Escheri...   910    0.0   
  UniRef100_M8LHT0 Osmolarity sensor protein envZ n=3 Tax=Escheri...   910    0.0   
  UniRef100_A0A017J8G1 Osmolarity sensor protein envZ n=1 Tax=Esc...   910    0.0   
  UniRef100_F1ZND8 Osmolarity sensor protein envZ n=1 Tax=Escheri...   910    0.0   
  UniRef100_M9BDR2 Osmolarity sensor protein envZ n=3 Tax=Escheri...   910    0.0   
  UniRef100_E3XSW3 Osmolarity sensor protein envZ n=6 Tax=Escheri...   909    0.0   
  UniRef100_I4SL62 Osmolarity sensor protein n=2 Tax=Escherichia ...   909    0.0   
  UniRef100_UPI0003A61B01 osmolarity sensor protein n=1 Tax=Esche...   909    0.0   
  UniRef100_N2KF50 Osmolarity sensor protein envZ n=1 Tax=Escheri...   909    0.0   
  UniRef100_M8Z9H5 Osmolarity sensor protein envZ n=5 Tax=Escheri...   909    0.0   
  UniRef100_F0JU54 Osmolarity sensor protein n=1 Tax=Escherichia ...   908    0.0   
  UniRef100_T8KCJ4 Osmolarity sensor protein envZ n=1 Tax=Escheri...   907    0.0   
  UniRef100_A0A017I764 Osmolarity sensor protein envZ n=1 Tax=Esc...   907    0.0   
  UniRef100_A0A017JMD2 Osmolarity sensor protein envZ n=1 Tax=Esc...   906    0.0   
  UniRef100_R8XC97 Osmolarity sensor protein envZ n=3 Tax=Escheri...   905    0.0   
  UniRef100_N4IYR8 Osmolarity sensor protein envZ n=1 Tax=Escheri...   902    0.0   
  UniRef100_D4BI29 Osmolarity sensor protein EnvZ n=3 Tax=Citroba...   895    0.0   
  UniRef100_D2TLN5 Two-component sensor kinase n=1 Tax=Citrobacte...   894    0.0   
  UniRef100_F8VKV3 Two-component sensor kinase EnvZ n=1 Tax=Salmo...   890    0.0   
  UniRef100_K8QVM6 Osmolarity sensor protein n=4 Tax=Citrobacter ...   890    0.0   
  UniRef100_P08982 Osmolarity sensor protein EnvZ n=738 Tax=Salmo...   888    0.0   
  UniRef100_E3Y890 Osmolarity sensor protein envZ n=2 Tax=Enterob...   887    0.0   
  UniRef100_H7EE26 ATPase, histidine kinase-, DNA gyrase B-, and ...   887    0.0   
  UniRef100_J1G337 Osmolarity sensor protein n=5 Tax=Enterobacter...   887    0.0   
  UniRef100_C1MD79 Osmolarity sensor protein envZ n=3 Tax=Enterob...   887    0.0   
  UniRef100_UPI0002BC5EEE osmolarity sensor protein n=1 Tax=Salmo...   887    0.0   
  UniRef100_L6Y156 Osmolarity sensor protein n=1 Tax=Salmonella e...   887    0.0   
  UniRef100_A8AQV8 Uncharacterized protein n=1 Tax=Citrobacter ko...   886    0.0   
  UniRef100_UPI0003180EAD osmolarity sensor protein n=1 Tax=Citro...   886    0.0   
  UniRef100_V2JUR3 Osmolarity sensor protein n=2 Tax=Salmonella e...   886    0.0   
  UniRef100_X3BRV1 Osmolarity sensor protein n=2 Tax=Salmonella e...   886    0.0   
  UniRef100_V0S378 Osmolarity sensor protein EnvZ n=1 Tax=Escheri...   885    0.0   
  UniRef100_P41406 Osmolarity sensor protein EnvZ n=5 Tax=Salmone...   885    0.0   
  UniRef100_X7HJP9 Osmolarity sensor protein envZ n=1 Tax=Citroba...   885    0.0   
  UniRef100_V2GZ44 Osmolarity sensor protein n=1 Tax=Salmonella e...   885    0.0   
  UniRef100_F2FVK7 Osmolarity sensor protein n=9 Tax=Salmonella e...   884    0.0   
  UniRef100_V1YS30 Osmolarity sensor protein n=1 Tax=Salmonella e...   884    0.0   
  UniRef100_UPI0003EB60BF osmolarity sensor protein n=1 Tax=Salmo...   884    0.0   
  UniRef100_UPI0003EB55CA osmolarity sensor protein n=1 Tax=Salmo...   884    0.0   
  UniRef100_A9MMC4 Uncharacterized protein n=1 Tax=Salmonella ari...   884    0.0   
  UniRef100_E8NSQ1 Osmolarity sensor protein n=4 Tax=Salmonella e...   884    0.0   
  UniRef100_X0N9Z6 Osmolarity sensor protein n=1 Tax=Salmonella e...   883    0.0   
  UniRef100_L9QGS1 Osmolarity sensor protein n=2 Tax=Salmonella e...   883    0.0   
  UniRef100_B4SVK4 Osmolarity sensor protein EnvZ n=9 Tax=Salmone...   883    0.0   
  UniRef100_S5N1A0 Osmolarity sensory histidine kinase EnvZ n=2 T...   882    0.0   
  UniRef100_X2M153 Osmolarity sensor protein n=10 Tax=Salmonella ...   880    0.0   
  UniRef100_I6HFG8 Osmolarity sensor protein envZ n=1 Tax=Shigell...   880    0.0   
  UniRef100_I0VW64 Integral membrane sensor signal transduction h...   879    0.0   
  UniRef100_V1PRL1 Osmolarity sensor protein n=2 Tax=Salmonella c...   878    0.0   
  UniRef100_F9I0E7 EnvZ n=1 Tax=Escherichia coli O104:H4 str. C22...   875    0.0   
  UniRef100_N1GR65 Osmolarity sensor protein EnvZ n=2 Tax=Salmone...   874    0.0   
  UniRef100_X3UUC8 Osmolarity sensor protein n=1 Tax=Salmonella e...   874    0.0   
  UniRef100_J7GQK1 Osmolarity sensor protein n=6 Tax=Enterobacter...   873    0.0   
  UniRef100_I6RDP2 Osmolarity sensor protein n=1 Tax=Enterobacter...   873    0.0   
  UniRef100_Y1GMK1 Osmolarity sensor protein envZ n=1 Tax=Enterob...   872    0.0   
  UniRef100_X5G3P4 Osmolarity sensor protein n=2 Tax=Enterobacter...   871    0.0   
  UniRef100_D2ZIR2 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   871    0.0   
  UniRef100_K4YB99 EnvZ Protein n=7 Tax=Enterobacter RepID=K4YB99...   870    0.0   
  UniRef100_G2S2H5 Integral membrane sensor signal transduction h...   870    0.0   
  UniRef100_V3HW98 Osmolarity sensor protein envZ n=2 Tax=Enterob...   870    0.0   
  UniRef100_G8LIB0 Osmolarity sensor protein envZ n=5 Tax=Enterob...   870    0.0   
  UniRef100_V3P7Q5 Osmolarity sensor protein envZ n=1 Tax=Enterob...   870    0.0   
  UniRef100_F5S2X8 Osmolarity sensor protein EnvZ n=34 Tax=Entero...   870    0.0   
  UniRef100_A4WFJ2 Integral membrane sensor signal transduction h...   869    0.0   
  UniRef100_V3MCS2 Osmolarity sensor protein envZ n=1 Tax=Enterob...   869    0.0   
  UniRef100_E3GB28 Integral membrane sensor signal transduction h...   868    0.0   
  UniRef100_S9ZBS6 Osmolarity sensor protein n=1 Tax=Enterobacter...   868    0.0   
  UniRef100_U7CH05 Osmolarity sensor protein envZ n=2 Tax=Enterob...   868    0.0   
  UniRef100_UPI0003A156E8 osmolarity sensor protein n=1 Tax=Enter...   867    0.0   
  UniRef100_D5CEG2 Osmolarity sensor protein n=1 Tax=Enterobacter...   865    0.0   
  UniRef100_T7X0A5 Osmolarity sensor protein envZ n=1 Tax=Escheri...   865    0.0   
  UniRef100_G9Z0P7 Osmolarity sensor protein EnvZ n=1 Tax=Yokenel...   863    0.0   
  UniRef100_J1QMQ6 Osmolarity sensor protein envZ n=1 Tax=Kosakon...   856    0.0   
  UniRef100_L0M0Z1 Signal transduction histidine kinase n=1 Tax=E...   856    0.0   
  UniRef100_W6J586 Osmolarity sensor protein n=1 Tax=Enterobacter...   855    0.0   
  UniRef100_R9VRP7 Osmolarity sensor protein n=1 Tax=Enterobacter...   855    0.0   
  UniRef100_V5AVK0 Osmolarity sensor protein envZ n=1 Tax=Enterob...   854    0.0   
  UniRef100_H3N490 Osmolarity sensor protein envZ n=1 Tax=Klebsie...   854    0.0   
  UniRef100_H3LEF2 Osmolarity sensor protein envZ n=4 Tax=Klebsie...   852    0.0   
  UniRef100_G8W720 Osmolarity sensor protein n=3 Tax=Klebsiella o...   852    0.0   
  UniRef100_I6XAH1 Osmolarity sensory histidine kinase EnvZ n=1 T...   850    0.0   
  UniRef100_A0A022H9D9 Osmolarity sensor protein envZ n=7 Tax=Kle...   850    0.0   
  UniRef100_K6KRA4 Osmolarity sensor protein n=1 Tax=Klebsiella o...   847    0.0   
  UniRef100_G5LUR5 Osmolarity sensory histidine kinase EnvZ n=1 T...   847    0.0   
  UniRef100_G0E6C9 Osmolarity sensor protein n=9 Tax=Enterobacter...   847    0.0   
  UniRef100_K8BCC7 Osmolarity sensory histidine kinase EnvZ n=1 T...   845    0.0   
  UniRef100_J0MGX4 Osmolarity sensor protein n=1 Tax=Enterobacter...   845    0.0   
  UniRef100_K8A9J3 Osmolarity sensory histidine kinase EnvZ n=1 T...   845    0.0   
  UniRef100_M9W438 Osmolarity sensor protein n=4 Tax=Enterobacter...   845    0.0   
  UniRef100_W9BBZ6 EnvZ protein n=186 Tax=Enterobacteriaceae RepI...   845    0.0   
  UniRef100_B5XTT3 Osmolarity sensor protein EnvZ n=2 Tax=Klebsie...   845    0.0   
  UniRef100_UPI0003694DA7 osmolarity sensor protein n=1 Tax=Klebs...   845    0.0   
  UniRef100_M7PRU3 Osmolarity sensor protein n=3 Tax=Klebsiella R...   845    0.0   
  UniRef100_G0GLG7 Osmolarity sensor protein n=15 Tax=Enterobacte...   845    0.0   
  UniRef100_D3RE41 Integral membrane sensor signal transduction h...   845    0.0   
  UniRef100_I6CB19 Osmolarity sensor protein envZ n=1 Tax=Shigell...   845    0.0   
  UniRef100_S3ILA2 Osmolarity sensor protein EnvZ n=1 Tax=Cedecea...   845    0.0   
  UniRef100_K8B4P8 Osmolarity sensory histidine kinase EnvZ n=1 T...   845    0.0   
  UniRef100_C9Y288 Osmolarity sensor protein envZ n=1 Tax=Cronoba...   845    0.0   
  UniRef100_W8Y5R3 Sensory histidine kinase in two-component regu...   844    0.0   
  UniRef100_F3QDA1 Osmolarity sensor protein EnvZ n=5 Tax=Bacteri...   843    0.0   
  UniRef100_V3D397 Osmolarity sensor protein envZ n=1 Tax=Klebsie...   843    0.0   
  UniRef100_Y1EMS9 Osmolarity sensor protein envZ n=2 Tax=Enterob...   843    0.0   
  UniRef100_K8A019 Osmolarity sensory histidine kinase EnvZ n=1 T...   843    0.0   
  UniRef100_K8DGS3 Osmolarity sensory histidine kinase EnvZ n=1 T...   843    0.0   
  UniRef100_V5TVS7 Osmolarity sensor protein n=3 Tax=Cronobacter ...   842    0.0   
  UniRef100_M5SV67 Osmolarity sensor protein envZ n=1 Tax=Klebsie...   842    0.0   
  UniRef100_I5ZG41 Protein histidine kinase/phosphatase sensor fo...   842    0.0   
  UniRef100_Z5G3Z7 Osmolarity sensor protein envZ n=1 Tax=Klebsie...   842    0.0   
  UniRef100_A7MGC8 Uncharacterized protein n=7 Tax=Cronobacter sa...   842    0.0   
  UniRef100_Z5I8D2 Osmolarity sensor protein envZ n=1 Tax=Klebsie...   842    0.0   
  UniRef100_Z5PVK5 Osmolarity sensor protein envZ n=1 Tax=Klebsie...   842    0.0   
  UniRef100_R4Y8F9 EnvZ protein n=1 Tax=Klebsiella pneumoniae Rep...   840    0.0   
  UniRef100_H5V3D5 Osmolarity two-component histidine kinase EnvZ...   840    0.0   
  UniRef100_L1FE87 Osmolarity sensor protein envZ n=1 Tax=Escheri...   835    0.0   
  UniRef100_I2B4A7 Osmolarity sensor protein EnvZ n=1 Tax=Shimwel...   828    0.0   
  UniRef100_UPI000369214D osmolarity sensor protein n=1 Tax=Enter...   827    0.0   
  UniRef100_X3X8B7 Osmolarity sensor protein (Fragment) n=1 Tax=S...   821    0.0   
  UniRef100_K6WM72 Osmolarity two-component histidine kinase EnvZ...   820    0.0   
  UniRef100_E6WH04 Integral membrane sensor signal transduction h...   815    0.0   
  UniRef100_B5BHF9 Two-component sensor kinase EnvZ n=6 Tax=Salmo...   813    0.0   
  UniRef100_B5R7L3 Two-component sensor kinase EnvZ n=1 Tax=Salmo...   810    0.0   
  UniRef100_U2M5C8 Osmolarity sensory histidine kinase EnvZ n=1 T...   808    0.0   
  UniRef100_J3D257 Signal transduction histidine kinase n=1 Tax=P...   807    0.0   
  UniRef100_J2UPM2 Signal transduction histidine kinase n=1 Tax=P...   806    0.0   
  UniRef100_UPI0003717709 osmolarity sensor protein n=1 Tax=Panto...   805    0.0   
  UniRef100_U1U1B2 Osmolarity sensor protein n=1 Tax=Pantoea disp...   804    0.0   
  UniRef100_L7ZUE3 Sensory histidine kinase in two-component regu...   804    0.0   
  UniRef100_W0T1Q0 Sensory histidine kinase in two-component regu...   803    0.0   
  UniRef100_E1SGV0 Osmolarity sensor protein EnvZ n=1 Tax=Pantoea...   803    0.0   
  UniRef100_H8DS34 Osmolarity sensor protein n=1 Tax=Pantoea sp. ...   803    0.0   
  UniRef100_X7FFU7 Osmolarity sensor protein envZ n=1 Tax=Serrati...   803    0.0   
  UniRef100_D2T9B6 Protein histidine kinase/phosphatase sensor fo...   802    0.0   
  UniRef100_U2N160 Osmolarity sensory histidine kinase EnvZ n=1 T...   802    0.0   
  UniRef100_E0M0P1 Integral membrane sensor signal transduction h...   802    0.0   
  UniRef100_H3RHN8 Sensory histidine kinase in two-component regu...   802    0.0   
  UniRef100_UPI000346458A osmolarity sensor protein n=1 Tax=Erwin...   801    0.0   
  UniRef100_D4GD23 EnvZ n=5 Tax=Pantoea ananas RepID=D4GD23_PANAM      801    0.0   
  UniRef100_UPI00020DA542 osmolarity sensor protein n=1 Tax=Plaut...   801    0.0   
  UniRef100_U4W6D0 Osmolarity sensor protein n=1 Tax=Pantoea aggl...   801    0.0   
  UniRef100_U2LQP9 Osmolarity sensory histidine kinase EnvZ n=1 T...   801    0.0   
  UniRef100_D8MY26 Osmolarity sensor protein n=1 Tax=Erwinia bill...   799    0.0   
  UniRef100_N1L9I4 Osmolarity sensor protein n=1 Tax=Yersinia ent...   799    0.0   
  UniRef100_A1JSI0 Osmolarity sensor protein n=2 Tax=Yersinia ent...   798    0.0   
  UniRef100_UPI00026D2812 osmolarity sensor protein n=1 Tax=Enter...   798    0.0   
  UniRef100_W0URN1 Osmolarity sensor protein n=1 Tax=Yersinia ent...   798    0.0   
  UniRef100_F0KVN9 Osmolarity sensor protein n=9 Tax=Yersinia ent...   798    0.0   
  UniRef100_S0ALC9 Osmolarity sensor protein EnvZ n=2 Tax=Serrati...   798    0.0   
  UniRef100_D4I336 Protein histidine kinase/phosphatase sensor fo...   798    0.0   
  UniRef100_G0BAF7 Integral membrane sensor signal transduction h...   798    0.0   
  UniRef100_W8TXW9 Osmolarity sensor protein EnvZ n=2 Tax=Yersini...   796    0.0   
  UniRef100_B2VJV0 Osmolarity sensor protein n=1 Tax=Erwinia tasm...   796    0.0   
  UniRef100_E7B847 Osmolarity sensory histidine kinase EnvZ n=4 T...   796    0.0   
  UniRef100_E8XV17 Integral membrane sensor signal transduction h...   795    0.0   
  UniRef100_UPI0002EFDD2E osmolarity sensor protein n=1 Tax=Serra...   795    0.0   
  UniRef100_V6D3I5 Protein histidine kinase/phosphatase sensor fo...   795    0.0   
  UniRef100_M3BKI4 Osmolarity sensor protein n=2 Tax=Serratia mar...   795    0.0   
  UniRef100_H2IQG1 Signal transduction histidine kinase n=1 Tax=R...   795    0.0   
  UniRef100_U3U262 Integral membrane sensor signal transduction h...   795    0.0   
  UniRef100_V5ZC79 Protein histidine kinase/phosphatase sensor fo...   794    0.0   
  UniRef100_W0LCJ4 Osmolarity sensor protein n=1 Tax=Serratia fon...   792    0.0   
  UniRef100_UPI000360DED8 osmolarity sensor protein n=1 Tax=gamma...   792    0.0   
  UniRef100_L0VTP0 Osmolarity sensor protein EnvZ n=1 Tax=Serrati...   791    0.0   
  UniRef100_I3ALC0 Osmolarity sensor protein n=1 Tax=Serratia ply...   791    0.0   
  UniRef100_A0A014NAW6 Osmolarity sensor protein n=1 Tax=Erwinia ...   789    0.0   
  UniRef100_L0MP79 Signal transduction histidine kinase n=1 Tax=S...   788    0.0   
  UniRef100_S5EQN5 Osmolarity sensor protein n=1 Tax=Serratia liq...   788    0.0   
  UniRef100_UPI000329B1B4 PREDICTED: osmolarity sensor protein En...   787    0.0   
  UniRef100_I0QWY2 Osmolarity sensor protein n=1 Tax=Serratia sp....   786    0.0   
  UniRef100_D4DYP0 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   786    0.0   
  UniRef100_E5YM27 Osmolarity sensor protein envZ n=1 Tax=Enterob...   786    0.0   
  UniRef100_G9Y419 Osmolarity sensor protein EnvZ n=1 Tax=Hafnia ...   785    0.0   
  UniRef100_W8G649 Osmolarity sensor protein n=1 Tax=Yersinia sim...   784    0.0   
  UniRef100_A7FNU9 Osmolarity sensor protein EnvZ n=1 Tax=Yersini...   783    0.0   
  UniRef100_A4TGS7 Osmolarity sensor protein n=91 Tax=Yersinia Re...   781    0.0   
  UniRef100_A8GKS3 Integral membrane sensor signal transduction h...   780    0.0   
  UniRef100_V5CBE4 Osmolarity sensor protein EnvZ n=1 Tax=Serrati...   780    0.0   
  UniRef100_Q74Y38 Osmolarity sensor protein n=1 Tax=Yersinia pes...   780    0.0   
  UniRef100_V9GRD1 Putative two-component histidine kinase (Fragm...   779    0.0   
  UniRef100_UPI000366BE7C osmolarity sensor protein n=1 Tax=Dicke...   779    0.0   
  UniRef100_UPI0002E5D800 osmolarity sensor protein n=1 Tax=Dicke...   777    0.0   
  UniRef100_D2BY53 Integral membrane sensor signal transduction h...   777    0.0   
  UniRef100_E0SJT2 Sensory histidine kinase in two-component regu...   777    0.0   
  UniRef100_C6CH25 Histidine kinase n=1 Tax=Dickeya zeae (strain ...   777    0.0   
  UniRef100_UPI0003A9E8B8 osmolarity sensor protein n=1 Tax=Dicke...   776    0.0   
  UniRef100_UPI0003A780B6 osmolarity sensor protein n=1 Tax=Dicke...   776    0.0   
  UniRef100_UPI0003A3478B osmolarity sensor protein n=1 Tax=Dicke...   776    0.0   
  UniRef100_U6ZD14 Two-component osmolarity sensor protein n=1 Ta...   776    0.0   
  UniRef100_O06468 EnvZ protein n=1 Tax=Yersinia enterocolitica R...   776    0.0   
  UniRef100_C6C7Z5 Histidine kinase n=1 Tax=Dickeya dadantii (str...   776    0.0   
  UniRef100_C5BGS5 Osmolarity sensor protein EnvZ, putative n=1 T...   775    0.0   
  UniRef100_D4FA97 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   775    0.0   
  UniRef100_V3TRQ7 Uncharacterized protein n=1 Tax=Serratia sp. A...   775    0.0   
  UniRef100_M4TMU2 Osmolarity sensor protein n=1 Tax=Edwardsiella...   774    0.0   
  UniRef100_D0ZG11 Osmolarity sensor protein n=2 Tax=Edwardsiella...   773    0.0   
  UniRef100_UPI00034A8282 osmolarity sensor protein n=1 Tax=Serra...   770    0.0   
  UniRef100_G7LV48 Integral membrane sensor signal transduction h...   770    0.0   
  UniRef100_UPI0001A44618 osmolarity sensor protein n=1 Tax=Pecto...   767    0.0   
  UniRef100_W0HNQ5 Osmolarity sensor protein 2-component sensor k...   766    0.0   
  UniRef100_C6DGE9 Histidine kinase n=1 Tax=Pectobacterium caroto...   765    0.0   
  UniRef100_C4T143 Osmolarity sensor protein envZ n=1 Tax=Yersini...   765    0.0   
  UniRef100_J8T1Z7 Osmolarity sensor protein n=1 Tax=Pectobacteri...   765    0.0   
  UniRef100_C4U8R2 Osmolarity sensor protein envZ n=1 Tax=Yersini...   764    0.0   
  UniRef100_D0KBD1 Integral membrane sensor signal transduction h...   764    0.0   
  UniRef100_R9NUM4 Osmolarity sensor protein n=1 Tax=Erwinia trac...   763    0.0   
  UniRef100_C4U2B3 Osmolarity sensor protein envZ n=1 Tax=Yersini...   763    0.0   
  UniRef100_C4SQE9 Osmolarity sensor protein envZ n=1 Tax=Yersini...   763    0.0   
  UniRef100_C4UUM8 Osmolarity sensor protein envZ n=1 Tax=Yersini...   763    0.0   
  UniRef100_J7L4A8 EnvZ protein n=2 Tax=Pectobacterium carotovoru...   762    0.0   
  UniRef100_C4RXN2 Osmolarity sensor protein envZ n=1 Tax=Yersini...   761    0.0   
  UniRef100_C4UH24 Osmolarity sensor protein envZ n=1 Tax=Yersini...   761    0.0   
  UniRef100_Q6CZP4 Two-component osmolarity sensor protein n=1 Ta...   761    0.0   
  UniRef100_W0HH31 Osmolarity sensory histidine kinase EnvZ n=1 T...   760    0.0   
  UniRef100_Q2NQI2 Two-component sensor kinase n=1 Tax=Sodalis gl...   759    0.0   
  UniRef100_C4SCQ6 Osmolarity sensor protein envZ n=1 Tax=Yersini...   759    0.0   
  UniRef100_E9CMX7 Putative sensory histidine kinase in two-compo...   756    0.0   
  UniRef100_W3V724 Signal transduction histidine kinase n=1 Tax=P...   634    2e-179
  UniRef100_T0QIB7 Osmolarity sensor protein n=1 Tax=Photorhabdus...   633    6e-179
  UniRef100_U7R0P4 Osmolarity sensor protein n=1 Tax=Photorhabdus...   632    1e-178
  UniRef100_C7BGS5 Osmolarity sensor protein EnvZ n=1 Tax=Photorh...   629    8e-178
  UniRef100_Q7N9U8 Osmolarity sensor protein n=1 Tax=Photorhabdus...   617    2e-174
  UniRef100_K8WIT4 Osmolarity sensor protein n=1 Tax=Providencia ...   589    8e-166
  UniRef100_K8WI61 Osmolarity sensor protein n=1 Tax=Providencia ...   583    6e-164
  UniRef100_W3YJZ2 GHKL domain protein n=2 Tax=Providencia alcali...   582    9e-164
  UniRef100_K8X1A7 Osmolarity sensor protein n=7 Tax=Providencia ...   579    1e-162
  UniRef100_I1B4M6 Integral membrane sensor signal transduction h...   577    4e-162
  UniRef100_I0DTN3 Osmolarity sensor protein n=2 Tax=Providencia ...   574    2e-161
  UniRef100_K8WU50 Osmolarity sensor protein n=1 Tax=Providencia ...   558    2e-156
  UniRef100_D2U2Z1 Two-component system, OmpR family, osmolarity ...   555    1e-155
  UniRef100_D4C2F1 Osmolarity sensor protein EnvZ n=1 Tax=Provide...   544    3e-152
  UniRef100_J7TBT7 Osmolarity sensory histidine kinase EnvZ n=2 T...   540    4e-151
  UniRef100_W1AGC4 Osmolarity sensory histidine kinase EnvZ n=1 T...   539    1e-150
  UniRef100_M7D0Z7 Osmolarity sensory histidine kinase EnvZ n=1 T...   539    1e-150
  UniRef100_D1P0V3 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   525    2e-146
  UniRef100_V6MFV6 Osmolarity sensor protein n=1 Tax=Proteus haus...   512    1e-142
  UniRef100_O31140 Histidine kinase sensor protein EnvZ (Fragment...   512    1e-142
  UniRef100_UPI0001911669 histidine kinase n=1 Tax=Salmonella cho...   509    9e-142
  UniRef100_O31141 Histidine kinase sensor protein EnvZ (Fragment...   503    5e-140
  UniRef100_B4EZJ4 Osmolarity sensor protein (Two-component syste...   501    3e-139
  UniRef100_K1GW62 Uncharacterized protein n=1 Tax=Proteus mirabi...   501    3e-139
  UniRef100_UPI0003815008 osmolarity sensor protein n=1 Tax=Prote...   498    2e-138
  UniRef100_C2LEV1 Osmolarity sensor protein EnvZ n=2 Tax=Proteus...   482    2e-133
  UniRef100_Q1Z2L1 Putative sensor outer membrane protein EnvZ n=...   474    2e-131
  UniRef100_D0Z1B7 Osmolarity sensory histidine kinase EnvZ n=1 T...   471    3e-130
  UniRef100_F2PBH8 Osmolarity sensor protein n=2 Tax=Photobacteri...   469    1e-129
  UniRef100_S5UY48 Osmolarity sensor protein n=1 Tax=Proteus mira...   468    3e-129
  UniRef100_W9ACJ2 Sensory histidine kinase in two-component regu...   466    1e-128
  UniRef100_D0I469 Osmolarity sensory histidine kinase EnvZ n=1 T...   465    2e-128
  UniRef100_Q1ZKA9 Osmolarity sensor protein n=1 Tax=Photobacteri...   462    1e-127
  UniRef100_Q2BYF8 Osmolarity sensor protein n=1 Tax=Photobacteri...   460    6e-127
  UniRef100_Q6LVQ1 Putative sensor outer membrane protein EnvZ n=...   457    6e-126
  UniRef100_UPI00030AC6B3 osmolarity sensor protein n=1 Tax=Enter...   451    3e-124
  UniRef100_UPI0002FCE490 osmolarity sensor protein n=1 Tax=Enter...   450    7e-124
  UniRef100_R1IM18 Osmolarity sensory histidine kinase EnvZ n=1 T...   449    1e-123
  UniRef100_UPI0002EBC259 osmolarity sensor protein n=1 Tax=Enter...   448    2e-123
  UniRef100_S7I5B4 Osmolarity sensory histidine kinase EnvZ n=2 T...   447    6e-123
  UniRef100_F0LRG6 Osmolarity sensor protein EnvZ n=1 Tax=Vibrio ...   446    8e-123
  UniRef100_L8J8Z0 Osmolarity sensory histidine kinase EnvZ n=1 T...   445    2e-122
  UniRef100_C9PJS1 Osmolarity sensory histidine kinase EnvZ n=1 T...   444    3e-122
  UniRef100_E8M506 Osmolarity sensor protein n=1 Tax=Vibrio sinal...   442    2e-121
  UniRef100_Q8DDU9 Osmolarity sensory histidine kinase EnvZ n=1 T...   440    5e-121
  UniRef100_E8VTI0 Osmolarity sensory histidine kinase EnvZ n=3 T...   440    5e-121
  UniRef100_E8LY90 Osmolarity sensor protein n=1 Tax=Vibrio brasi...   440    8e-121
  UniRef100_UPI0003095640 osmolarity sensor protein n=1 Tax=Vibri...   439    1e-120
  UniRef100_B8K8X5 Osmolarity sensor protein EnvZ n=1 Tax=Vibrio ...   438    2e-120
  UniRef100_C9P1T1 Osmolarity sensory histidine kinase EnvZ n=1 T...   437    6e-120
  UniRef100_F9T8K1 Osmolarity sensor protein n=2 Tax=Vibrio tubia...   437    7e-120
  UniRef100_A6D0J4 Osmolarity sensor protein n=1 Tax=Vibrio shilo...   436    2e-119
  UniRef100_J1MPU4 Osmolarity sensor protein envZ n=1 Tax=Vibrio ...   436    2e-119
  UniRef100_C3NUH4 Osmolarity sensory histidine kinase EnvZ n=94 ...   434    3e-119
  UniRef100_F9B607 Osmolarity sensor protein envZ n=1 Tax=Vibrio ...   434    3e-119
  UniRef100_B6EPQ4 Sensor outer membrane protein EnvZ n=1 Tax=Ali...   434    3e-119
  UniRef100_J1MNU5 Osmolarity sensor protein envZ n=1 Tax=Vibrio ...   434    4e-119
  UniRef100_A3EJD4 Osmolarity sensor protein EnvZ n=2 Tax=Vibrio ...   434    4e-119
  UniRef100_U4ZQR1 Osmolarity sensor protein n=2 Tax=Vibrio mimic...   434    5e-119
  UniRef100_J1DD82 Osmolarity sensor protein envZ n=4 Tax=Vibrio ...   434    5e-119
  UniRef100_M5NBW9 Osmolarity sensor protein EnvZ n=1 Tax=Vibrio ...   434    6e-119
  UniRef100_F9C2A8 Osmolarity sensor protein envZ n=1 Tax=Vibrio ...   433    6e-119
  UniRef100_D0GX33 Osmolarity sensory histidine kinase EnvZ n=1 T...   433    6e-119
  UniRef100_D0HIW1 Osmolarity sensory histidine kinase EnvZ n=1 T...   433    8e-119
  UniRef100_F2IN96 Osmolarity sensory histidine kinase EnvZ n=2 T...   433    8e-119
  UniRef100_D2YF94 Osmolarity sensor protein envZ n=1 Tax=Vibrio ...   433    9e-119
  UniRef100_D2YL71 Osmolarity sensor protein envZ n=2 Tax=Vibrio ...   432    2e-118
  UniRef100_C3LSE0 Osmolarity sensor protein EnvZ n=1 Tax=Vibrio ...   431    2e-118
  UniRef100_F9AJR6 Osmolarity sensor protein envZ n=3 Tax=Vibrio ...   431    3e-118
  UniRef100_A6A2A3 Osmolarity sensor protein EnvZ n=2 Tax=Vibrio ...   431    3e-118
  UniRef100_D0HXA7 Osmolarity sensory histidine kinase EnvZ n=1 T...   431    4e-118
  UniRef100_F9RCU2 Osmolarity sensor protein n=1 Tax=Vibrio sp. N...   431    5e-118
  UniRef100_C2HY47 Osmolarity sensory histidine kinase EnvZ n=1 T...   430    5e-118
  UniRef100_A6XUG6 Osmolarity sensor protein EnvZ n=1 Tax=Vibrio ...   430    5e-118
  UniRef100_A7MSS2 Osmolarity sensor protein n=1 Tax=Vibrio campb...   430    5e-118
  UniRef100_A5F4T2 Osmolarity sensor protein EnvZ n=9 Tax=Vibrio ...   430    6e-118
  UniRef100_Q5E8N6 EnvZ osmolarity sensory histidine kinase in tw...   430    6e-118
  UniRef100_D0IEB0 Osmolarity sensory histidine kinase EnvZ n=1 T...   430    8e-118
  UniRef100_UPI0002D3F02A osmolarity sensor protein n=1 Tax=Vibri...   429    1e-117
  UniRef100_F9BPV3 Osmolarity sensor protein envZ n=18 Tax=Vibrio...   429    1e-117
  UniRef100_C9NLJ0 Osmolarity sensory histidine kinase EnvZ n=1 T...   429    1e-117
  UniRef100_C9Q5A7 Osmolarity sensory histidine kinase EnvZ n=1 T...   429    1e-117
  UniRef100_F9AUW9 Osmolarity sensor protein envZ n=3 Tax=Vibrio ...   428    2e-117
  UniRef100_C2I6M7 Osmolarity sensory histidine kinase EnvZ n=2 T...   428    2e-117
  UniRef100_UPI0002E93B30 osmolarity sensor protein n=1 Tax=Aliiv...   428    2e-117
  UniRef100_C9QDL4 Osmolarity sensor protein n=1 Tax=Vibrio orien...   428    3e-117
  UniRef100_UPI0002E007DC osmolarity sensor protein n=1 Tax=Aliiv...   427    4e-117
  UniRef100_A6AR92 Osmolarity sensor protein EnvZ n=2 Tax=Vibrio ...   427    5e-117
  UniRef100_D0X502 Osmolarity sensor protein envZ n=1 Tax=Vibrio ...   426    7e-117
  UniRef100_K5TTM4 Osmolarity sensor protein envZ n=3 Tax=Vibrio ...   426    8e-117
  UniRef100_B5FFE6 Osmolarity sensor protein EnvZ n=1 Tax=Vibrio ...   426    1e-116
  UniRef100_F9RQW6 Osmolarity sensor protein n=1 Tax=Vibrio scoph...   426    1e-116
  UniRef100_E7K622 Osmolarity sensor envZ domain protein n=2 Tax=...   424    3e-116
  UniRef100_A8T6H5 Osmolarity sensor protein n=1 Tax=Vibrio sp. A...   424    3e-116
  UniRef100_F9S5F4 Osmolarity sensor protein n=1 Tax=Vibrio ichth...   424    4e-116
  UniRef100_U2ZZY5 Osmolarity two-component histidine kinase EnvZ...   424    4e-116
  UniRef100_UPI0002375CC3 osmolarity sensor protein n=1 Tax=Vibri...   423    8e-116
  UniRef100_U3CBE2 Osmolarity two-component histidine kinase EnvZ...   422    1e-115
  UniRef100_UPI0002F1F5D5 hypothetical protein n=1 Tax=Vibrio rum...   422    2e-115
  UniRef100_M2TUB4 Osmolarity sensory histidine kinase EnvZ n=1 T...   422    2e-115
  UniRef100_D0M3L8 Osmolarity sensory histidine kinase EnvZ n=2 T...   421    2e-115
  UniRef100_UPI0003183572 osmolarity sensor protein n=1 Tax=Vibri...   419    1e-114
  UniRef100_UPI0002FCA42C osmolarity sensor protein n=1 Tax=Vibri...   419    2e-114
  UniRef100_B7VHH7 Osmolarity sensor protein envZ n=2 Tax=Vibrio ...   419    2e-114
  UniRef100_D0WW58 Osmolarity sensor protein envZ n=1 Tax=Vibrio ...   419    2e-114
  UniRef100_UPI00030A306B osmolarity sensor protein n=1 Tax=Vibri...   419    2e-114
  UniRef100_F9SJB9 Osmolarity sensor protein n=1 Tax=Vibrio splen...   418    2e-114
  UniRef100_UPI0002F27DBB osmolarity sensor protein n=1 Tax=Vibri...   418    2e-114
  UniRef100_UPI0002DDF126 osmolarity sensor protein n=1 Tax=Vibri...   418    2e-114
  UniRef100_UPI0003129BA7 osmolarity sensor protein n=1 Tax=Vibri...   418    2e-114
  UniRef100_UPI00030FAB74 osmolarity sensor protein n=1 Tax=Vibri...   418    2e-114
  UniRef100_UPI0002E8CA3F osmolarity sensor protein n=1 Tax=Vibri...   418    3e-114
  UniRef100_U3BVN6 Osmolarity sensor protein envZ n=1 Tax=Vibrio ...   418    3e-114
  UniRef100_L8XNJ8 Osmolarity sensor protein n=1 Tax=Vibrio campb...   417    3e-114
  UniRef100_UPI0002F375E5 osmolarity sensor protein n=1 Tax=Vibri...   417    4e-114
  UniRef100_U4EE03 Osmolarity sensor protein envZ n=3 Tax=Vibrio ...   417    4e-114
  UniRef100_UPI0002DD4E51 osmolarity sensor protein n=1 Tax=Vibri...   417    4e-114
  UniRef100_F7YP48 EnvZ n=2 Tax=Listonella anguillarum serovar O1...   417    7e-114
  UniRef100_A0A011RMU7 HAMP domain protein n=3 Tax=Vibrio parahae...   416    1e-113
  UniRef100_W3ZEH1 HAMP domain protein n=1 Tax=Vibrio parahaemoly...   416    2e-113
  UniRef100_UPI00031B2ACD osmolarity sensor protein n=1 Tax=Vibri...   415    2e-113
  UniRef100_U4KAE9 Osmolarity sensor protein envZ n=12 Tax=Vibrio...   415    2e-113
  UniRef100_U4ZTU5 Osmolarity sensory histidine kinase EnvZ n=1 T...   415    2e-113
  UniRef100_UPI0002D3F2FD MULTISPECIES: osmolarity sensor protein...   415    2e-113
  UniRef100_UPI00026C4BFE osmolarity sensor protein n=1 Tax=Vibri...   415    3e-113
  UniRef100_R8ASQ3 Osmolarity sensor protein n=1 Tax=Plesiomonas ...   414    3e-113
  UniRef100_W2B702 HAMP domain protein n=1 Tax=Vibrio parahaemoly...   414    4e-113
  UniRef100_U4JLH2 Osmolarity sensor protein envZ n=1 Tax=Vibrio ...   414    4e-113
  UniRef100_Q1VAN4 Osmolarity sensor protein n=1 Tax=Vibrio algin...   414    5e-113
  UniRef100_L0HST9 Osmolarity sensory histidine kinase EnvZ n=41 ...   414    5e-113
  UniRef100_E3BIY6 Osmolarity sensor protein n=1 Tax=Vibrio carib...   414    6e-113
  UniRef100_E1DDL2 Osmolarity sensor protein EnvZ n=1 Tax=Vibrio ...   413    7e-113
  UniRef100_S5JR24 Osmolarity sensor protein n=1 Tax=Vibrio parah...   413    8e-113
  UniRef100_W6DDW8 Osmolarity sensory histidine kinase EnvZ n=1 T...   412    1e-112
  UniRef100_UPI00024832B3 osmolarity sensor protein n=1 Tax=Vibri...   411    3e-112
  UniRef100_A5KYP2 Osmolarity sensor protein n=1 Tax=Vibrionales ...   410    7e-112
  UniRef100_A3UPD0 Osmolarity sensor protein EnvZ n=1 Tax=Vibrio ...   409    2e-111
  UniRef100_UPI0002F8F6B0 osmolarity sensor protein n=1 Tax=Vibri...   407    4e-111
  UniRef100_S6JX41 Osmolarity sensor protein n=1 Tax=Vibrio natri...   405    1e-110
  UniRef100_U0EII6 Osmolarity sensor protein n=1 Tax=Vibrio coral...   405    2e-110
  UniRef100_H2IBT8 Osmolarity sensor protein n=1 Tax=Vibrio sp. E...   404    3e-110
  UniRef100_UPI000362B820 osmolarity sensor protein n=1 Tax=Vibri...   402    2e-109
  UniRef100_UPI0003818809 osmolarity sensor protein n=1 Tax=Vibri...   400    7e-109
  UniRef100_UPI0001912D13 osmolarity sensor protein, partial n=1 ...   394    3e-107
  UniRef100_L6YS74 Osmolarity sensor protein (Fragment) n=1 Tax=S...   394    5e-107
  UniRef100_U3CH41 Putative two-component histidine kinase n=1 Ta...   382    2e-103
  UniRef100_Q089I5 Periplasmic sensor signal transduction histidi...   378    3e-102
  UniRef100_Q12IB2 ATP-binding region, ATPase-like protein n=1 Ta...   378    4e-102
  UniRef100_UPI000371DF19 histidine kinase n=1 Tax=Colwellia piez...   377    5e-102
  UniRef100_A8FPK7 Integral membrane sensor signal transduction h...   376    1e-101
  UniRef100_V5FDR4 Osmolarity two-component histidine kinase EnvZ...   375    3e-101
  UniRef100_E6XQ38 Periplasmic sensor histidine kinase for osmola...   374    4e-101
  UniRef100_A8H9U1 Histidine kinase n=1 Tax=Shewanella pealeana (...   374    5e-101
  UniRef100_A4YC70 Integral membrane sensor signal transduction h...   374    5e-101
  UniRef100_A1RE64 Integral membrane sensor signal transduction h...   374    5e-101
  UniRef100_G0DM67 Integral membrane sensor signal transduction h...   370    5e-100
  UniRef100_G0AVG6 Integral membrane sensor signal transduction h...   370    6e-100
  UniRef100_E6T8V1 Integral membrane sensor signal transduction h...   369    1e-99 
  UniRef100_B8ECP4 Histidine kinase n=1 Tax=Shewanella baltica (s...   369    1e-99 
  UniRef100_Q47VC9 Osmolarity sensor protein EnvZ n=1 Tax=Colwell...   369    1e-99 
  UniRef100_F7RU60 Osmolarity sensory histidine kinase EnvZ n=1 T...   369    2e-99 
  UniRef100_A6WU34 Integral membrane sensor signal transduction h...   369    2e-99 
  UniRef100_K2KV86 Osmolarity sensor protein n=1 Tax=Idiomarina x...   365    2e-98 
  UniRef100_UPI0003140716 hypothetical protein n=1 Tax=Vibrio bre...   365    3e-98 
  UniRef100_A3QJ56 Integral membrane sensor signal transduction h...   365    3e-98 
  UniRef100_V1DLP5 Osmolarity sensor protein n=1 Tax=Shewanella d...   365    3e-98 
  UniRef100_Q0HDJ2 Periplasmic sensor signal transduction histidi...   365    3e-98 
  UniRef100_Q0HPS5 Periplasmic sensor signal transduction histidi...   364    5e-98 
  UniRef100_B1KM37 Integral membrane sensor signal transduction h...   363    9e-98 
  UniRef100_F9I5Q1 EnvZ n=1 Tax=Escherichia coli O104:H4 str. C22...   363    1e-97 
  UniRef100_UPI000370E4C0 hypothetical protein n=1 Tax=Vibrio bre...   362    1e-97 
  UniRef100_Q8E8M9 Osmolarity-responsive two component signal tra...   361    5e-97 
  UniRef100_A0L2G6 ATP-binding region, ATPase domain protein doma...   360    5e-97 
  UniRef100_D4ZDK9 Osmolarity sensor protein EnvZ n=1 Tax=Shewane...   360    9e-97 
  UniRef100_F7NTH4 Signal transduction histidine kinase n=1 Tax=R...   356    9e-96 
  UniRef100_A3WJ65 Signal transduction histidine kinase (Contains...   356    9e-96 
  UniRef100_K2J3E6 Osmolarity sensor protein n=1 Tax=Gallaecimona...   351    3e-94 
  UniRef100_A9CY67 Osmolarity sensor protein n=1 Tax=Shewanella b...   349    1e-93 
  UniRef100_B8CV10 ATP-binding region, ATPase-like:Histidine kina...   348    4e-93 
  UniRef100_B0TNR2 Histidine kinase n=1 Tax=Shewanella halifaxens...   347    6e-93 
  UniRef100_Q15ZD0 Periplasmic sensor signal transduction histidi...   347    9e-93 
  UniRef100_K1H1A3 Uncharacterized protein n=1 Tax=Proteus mirabi...   346    1e-92 
  UniRef100_UPI00036B4920 histidine kinase n=1 Tax=Rheinheimera p...   346    1e-92 
  UniRef100_F4AHH8 Integral membrane sensor signal transduction h...   345    3e-92 
  UniRef100_K6YJI3 Two-component system, OmpR family, osmolarity ...   345    3e-92 
  UniRef100_I1DZQ8 Two-component system, OmpR family, osmolarity ...   341    3e-91 
  UniRef100_K7AJD1 Two-component system, OmpR family, osmolarity ...   340    6e-91 
  UniRef100_A1SBF7 Osmolarity sensor protein EnvZ n=1 Tax=Shewane...   337    6e-90 
  UniRef100_U1JM58 Osmolarity sensor protein n=1 Tax=Pseudoaltero...   337    6e-90 
  UniRef100_A0Y499 Osmolarity sensor protein n=2 Tax=Alteromonada...   336    1e-89 
  UniRef100_E1SL29 Integral membrane sensor signal transduction h...   333    8e-89 
  UniRef100_G2H0W0 His Kinase A n=1 Tax=Candidatus Regiella insec...   333    8e-89 
  UniRef100_G7EFN0 Two-component system, OmpR family, osmolarity ...   331    4e-88 
  UniRef100_G7F6D6 Two-component system, OmpR family, osmolarity ...   331    5e-88 
  UniRef100_U1IT12 Osmolarity sensor protein n=1 Tax=Pseudoaltero...   330    7e-88 
  UniRef100_UPI0002EDDD17 histidine kinase n=1 Tax=Pseudoalteromo...   330    9e-88 
  UniRef100_F3BI35 Osmolarity sensory histidine kinase EnvZ n=1 T...   330    1e-87 
  UniRef100_UPI00035C33F2 hypothetical protein n=1 Tax=Algicola s...   329    1e-87 
  UniRef100_G7FG10 Two-component system, OmpR family, osmolarity ...   329    2e-87 
  UniRef100_E6RKY1 Osmolarity sensor protein n=1 Tax=Pseudoaltero...   329    2e-87 
  UniRef100_U1LEE2 Osmolarity sensor protein n=2 Tax=Pseudoaltero...   329    2e-87 
  UniRef100_Z5XQ78 Histidine kinase n=1 Tax=Pseudoalteromonas lip...   328    2e-87 
  UniRef100_UPI0002DC3719 histidine kinase n=1 Tax=Pseudoalteromo...   328    3e-87 
  UniRef100_W1YVT6 Histidine kinase n=1 Tax=Pseudoalteromonas sp....   328    3e-87 
  UniRef100_N6W6J6 Osmolarity sensor protein n=1 Tax=Pseudoaltero...   328    4e-87 
  UniRef100_G2H0W1 Osmolarity sensor protein n=1 Tax=Candidatus R...   327    5e-87 
  UniRef100_G7G7B3 Two-component system, OmpR family, osmolarity ...   327    5e-87 
  UniRef100_U1LM40 Osmolarity sensor protein n=1 Tax=Pseudoaltero...   327    8e-87 
  UniRef100_Z9K4U2 Histidine kinase n=1 Tax=Pseudoalteromonas sp....   324    6e-86 
  UniRef100_A4CEU2 Osmolarity sensor protein n=1 Tax=Pseudoaltero...   323    7e-86 
  UniRef100_UPI00036A030E hypothetical protein n=1 Tax=Salinimona...   323    7e-86 
  UniRef100_K6YYR9 Two-component system, OmpR family, osmolarity ...   323    7e-86 
  UniRef100_Q3IJP1 Sensory histidine kinase (Phosphorylase) in tw...   323    7e-86 
  UniRef100_R1H9K2 Osmolarity sensor protein n=1 Tax=Aeromonas mo...   323    8e-86 
  UniRef100_Q5QW85 Signal transduction histidine kinase (Contains...   322    3e-85 
  UniRef100_F4DGF3 Two-component system osmolarity sensor histidi...   321    3e-85 
  UniRef100_U1H287 Histidine kinase n=1 Tax=Aeromonas veronii Hm2...   321    4e-85 
  UniRef100_K1I6H5 Uncharacterized protein n=2 Tax=Aeromonas vero...   320    6e-85 
  UniRef100_UPI00030D202C histidine kinase n=1 Tax=Aeromonas sp. ...   320    8e-85 
  UniRef100_UPI00034A213A histidine kinase n=1 Tax=Pseudoalteromo...   319    1e-84 
  UniRef100_V4HQ12 Signal transduction histidine kinase n=1 Tax=P...   319    2e-84 
  UniRef100_H3ZF37 Osmolarity sensor protein n=1 Tax=Alishewanell...   319    2e-84 
  UniRef100_J1Y9I2 Osmolarity sensor protein n=1 Tax=Alishewanell...   319    2e-84 
  UniRef100_I9DQM6 Osmolarity sensor protein n=1 Tax=Alishewanell...   318    3e-84 
  UniRef100_X4UPD1 Histidine kinase n=2 Tax=Bacteria RepID=X4UPD1...   318    4e-84 
  UniRef100_F5ZFZ3 Osmolarity sensor protein n=1 Tax=Alteromonas ...   318    4e-84 
  UniRef100_R4VNS2 Osmolarity sensor protein n=2 Tax=Aeromonas hy...   318    4e-84 
  UniRef100_K6YMQ2 Two-component system, OmpR family, osmolarity ...   317    5e-84 
  UniRef100_N9VIR7 Osmolarity sensor protein n=1 Tax=Aeromonas di...   317    5e-84 
  UniRef100_K1J7C6 Uncharacterized protein n=1 Tax=Aeromonas hydr...   317    6e-84 
  UniRef100_V9ZU37 Osmolarity sensor protein n=1 Tax=Aeromonas hy...   317    6e-84 
  UniRef100_UPI0003139FD5 histidine kinase n=1 Tax=Aeromonas hydr...   317    8e-84 
  UniRef100_K0EK27 Osmolarity sensor protein n=1 Tax=Alteromonas ...   317    9e-84 
  UniRef100_K0D2Y9 Osmolarity sensor protein n=1 Tax=Alteromonas ...   317    9e-84 
  UniRef100_T0PFZ3 Osmolarity sensor protein n=1 Tax=Aeromonas sa...   317    9e-84 
  UniRef100_A0KF18 Osmolarity sensor protein EnvZ n=1 Tax=Aeromon...   317    9e-84 
  UniRef100_J9YGM6 Osmolarity sensor protein n=2 Tax=Alteromonas ...   316    1e-83 
  UniRef100_UPI0003658E5C histidine kinase n=1 Tax=Aeromonas hydr...   316    1e-83 
  UniRef100_K1ITY1 Uncharacterized protein n=1 Tax=Aeromonas vero...   316    2e-83 
  UniRef100_L8D8T5 Osmolarity sensory histidine kinase EnvZ n=1 T...   315    2e-83 
  UniRef100_F2GBK4 Histidine kinase n=8 Tax=Alteromonas macleodii...   315    2e-83 
  UniRef100_H5TAT3 Two-component system, OmpR family, osmolarity ...   315    3e-83 
  UniRef100_UPI000191166A osmolarity sensor protein n=1 Tax=Salmo...   314    6e-83 
  UniRef100_A0A010QZL2 Signal transduction histidine kinase n=1 T...   313    8e-83 
  UniRef100_UPI0002197FB8 histidine kinase n=1 Tax=Aeromonas cavi...   313    1e-82 
  UniRef100_K2I481 EnvZ n=1 Tax=Aeromonas media WS RepID=K2I481_A...   312    2e-82 
  UniRef100_A0A023E450 Osmolarity sensor protein EnvZ n=1 Tax=Aer...   311    4e-82 
  UniRef100_A4ST09 Two-component system osmolarity sensor histidi...   310    1e-81 
  UniRef100_K6ZB65 Two-component system, OmpR family, osmolarity ...   308    5e-81 
  UniRef100_G4QND7 Osmolarity sensor protein n=1 Tax=Glaciecola n...   307    7e-81 
  UniRef100_K7AHG6 Osmolarity sensor protein n=1 Tax=Glaciecola p...   305    2e-80 
  UniRef100_UPI00029B1819 histidine kinase n=1 Tax=Pseudoalteromo...   305    3e-80 
  UniRef100_UPI0002F7EB29 histidine kinase n=1 Tax=Pseudoalteromo...   304    6e-80 
  UniRef100_U1L8H0 Osmolarity sensor protein n=1 Tax=Pseudoaltero...   300    1e-78 
  UniRef100_UPI0000E10DFD histidine kinase n=1 Tax=Glaciecola sp....   299    2e-78 
  UniRef100_D3UYG0 EnvZ n=1 Tax=Xenorhabdus bovienii (strain SS-2...   289    1e-75 
  UniRef100_D3VF00 EnvZ n=2 Tax=Xenorhabdus nematophila RepID=D3V...   288    5e-75 
  UniRef100_Q56825 EnvZ n=1 Tax=Xenorhabdus nematophila RepID=Q56...   287    7e-75 
  UniRef100_W1V7Q4 Osmolarity sensor protein EnvZ (Fragment) n=1 ...   286    1e-74 
  UniRef100_F7S0J4 Signal transduction histidine kinase n=1 Tax=I...   283    1e-73 
  UniRef100_C0AUF4 Osmolarity sensor protein EnvZ n=1 Tax=Proteus...   283    1e-73 
  UniRef100_W1IPG2 EnvZ n=1 Tax=Xenorhabdus cabanillasii JM26 Rep...   272    2e-70 
  UniRef100_C7R8G4 Histidine kinase n=1 Tax=Kangiella koreensis (...   267    9e-69 
  UniRef100_W1J2M2 EnvZ n=1 Tax=Xenorhabdus szentirmaii DSM 16338...   267    9e-69 
  UniRef100_UPI00036B978F hypothetical protein n=1 Tax=Kangiella ...   263    1e-67 
  UniRef100_O31143 Histidine kinase sensor protein EnvZ (Fragment...   263    1e-67 
  UniRef100_UPI0002E11E36 sensory histidine kinase n=1 Tax=Acinet...   244    7e-62 
  UniRef100_N9D0N4 Uncharacterized protein n=1 Tax=Acinetobacter ...   244    7e-62 
  UniRef100_N8RR33 Uncharacterized protein n=1 Tax=Acinetobacter ...   244    8e-62 
  UniRef100_D0SEX0 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   244    8e-62 
  UniRef100_UPI00039F880E ATPase n=1 Tax=Pseudomonas pelagia RepI...   243    1e-61 
  UniRef100_K2PG29 Uncharacterized protein n=1 Tax=Acinetobacter ...   240    9e-61 
  UniRef100_L9MTK4 GHKL domain protein n=2 Tax=Acinetobacter RepI...   240    9e-61 
  UniRef100_N8X6P5 Uncharacterized protein n=1 Tax=Acinetobacter ...   240    1e-60 
  UniRef100_A0A009MPI3 HAMP domain protein n=2 Tax=Acinetobacter ...   239    3e-60 
  UniRef100_A0A009ITF0 HAMP domain protein n=27 Tax=Acinetobacter...   239    3e-60 
  UniRef100_UPI00024875ED sensory histidine kinase n=1 Tax=Acinet...   238    4e-60 
  UniRef100_N9DMF4 Uncharacterized protein n=1 Tax=Acinetobacter ...   238    5e-60 
  UniRef100_K5XD46 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   237    8e-60 
  UniRef100_R9AQY1 Two-component system, OmpR family, osmolarity ...   236    1e-59 
  UniRef100_H0JEX3 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   236    1e-59 
  UniRef100_N8QCK8 Uncharacterized protein n=1 Tax=Acinetobacter ...   236    2e-59 
  UniRef100_K8ZSL9 GHKL domain protein n=1 Tax=Acinetobacter baum...   235    3e-59 
  UniRef100_UPI0002FB9F01 sensory histidine kinase n=1 Tax=Acinet...   235    3e-59 
  UniRef100_D8JLQ9 Two-component system sensory histidine kinase ...   234    4e-59 
  UniRef100_A0A010ISG8 HAMP domain protein n=6 Tax=Acinetobacter ...   234    6e-59 
  UniRef100_A0A013RMC6 HAMP domain protein n=1 Tax=Acinetobacter ...   234    6e-59 
  UniRef100_A0A009K1A2 HAMP domain protein n=6 Tax=Acinetobacter ...   234    6e-59 
  UniRef100_N8X9Q0 Uncharacterized protein n=1 Tax=Acinetobacter ...   234    7e-59 
  UniRef100_N9MGN3 Uncharacterized protein n=3 Tax=Acinetobacter ...   233    9e-59 
  UniRef100_R8Y0F3 Uncharacterized protein n=1 Tax=Acinetobacter ...   233    1e-58 
  UniRef100_N8SFG1 Uncharacterized protein n=1 Tax=Acinetobacter ...   233    1e-58 
  UniRef100_W3SWX7 HAMP domain protein n=1 Tax=Acinetobacter baum...   233    2e-58 
  UniRef100_R8YA43 Uncharacterized protein n=1 Tax=Acinetobacter ...   232    2e-58 
  UniRef100_D0S4I6 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   232    3e-58 
  UniRef100_N8V608 Uncharacterized protein n=4 Tax=Acinetobacter ...   232    3e-58 
  UniRef100_V2TLI4 Uncharacterized protein n=1 Tax=Acinetobacter ...   231    4e-58 
  UniRef100_N8UGX5 Uncharacterized protein n=1 Tax=Acinetobacter ...   231    4e-58 
  UniRef100_R8YYT8 Uncharacterized protein n=1 Tax=Acinetobacter ...   231    5e-58 
  UniRef100_A0A010GK46 HAMP domain protein n=10 Tax=Acinetobacter...   231    6e-58 
  UniRef100_N8PP38 Uncharacterized protein n=1 Tax=Acinetobacter ...   231    6e-58 
  UniRef100_N8XDG6 Uncharacterized protein n=1 Tax=Acinetobacter ...   231    7e-58 
  UniRef100_UPI00034BEAEA sensory histidine kinase n=1 Tax=Acinet...   231    7e-58 
  UniRef100_A0A009GPJ0 HAMP domain protein n=7 Tax=Acinetobacter ...   230    8e-58 
  UniRef100_A0A010MMC3 HAMP domain protein n=2 Tax=Acinetobacter ...   230    8e-58 
  UniRef100_A0A013TEE7 HAMP domain protein n=1 Tax=Acinetobacter ...   230    8e-58 
  UniRef100_N8Q472 Uncharacterized protein n=1 Tax=Acinetobacter ...   230    8e-58 
  UniRef100_A0A009R5U0 HAMP domain protein n=1 Tax=Acinetobacter ...   230    9e-58 
  UniRef100_N9LN87 Uncharacterized protein n=1 Tax=Acinetobacter ...   230    1e-57 
  UniRef100_UPI0002DDAD27 ATPase n=1 Tax=Pseudomonas sp. 313 RepI...   229    1e-57 
  UniRef100_N9EQZ4 Uncharacterized protein n=1 Tax=Acinetobacter ...   229    2e-57 
  UniRef100_A0A009FSV4 HAMP domain protein n=1 Tax=Acinetobacter ...   229    2e-57 
  UniRef100_N9FAD4 Uncharacterized protein n=1 Tax=Acinetobacter ...   229    2e-57 
  UniRef100_S3MRU6 Two-component system, OmpR family, osmolarity ...   229    2e-57 
  UniRef100_C0VN11 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   228    5e-57 
  UniRef100_N8WYY8 Uncharacterized protein n=1 Tax=Acinetobacter ...   227    8e-57 
  UniRef100_U7HN52 ATPase n=1 Tax=Alcanivorax sp. PN-3 RepID=U7HN...   227    9e-57 
  UniRef100_K0C5U7 ATPase, histidine kinase-, DNA gyrase B-, and ...   227    9e-57 
  UniRef100_N9P9F9 Uncharacterized protein n=1 Tax=Acinetobacter ...   227    1e-56 
  UniRef100_N8PRD4 Uncharacterized protein n=1 Tax=Acinetobacter ...   226    2e-56 
  UniRef100_U3HEJ5 ATPase n=1 Tax=Pseudomonas alcaligenes OT 69 R...   226    2e-56 
  UniRef100_N8TEG7 Uncharacterized protein n=2 Tax=Acinetobacter ...   226    2e-56 
  UniRef100_W5IMH2 ATPase n=1 Tax=Pseudomonas sp. (strain M1) Rep...   226    2e-56 
  UniRef100_V4QAR2 ATPase n=1 Tax=Pseudomonas chloritidismutans A...   225    3e-56 
  UniRef100_N8RII7 Uncharacterized protein n=1 Tax=Acinetobacter ...   225    3e-56 
  UniRef100_N8X435 Uncharacterized protein n=1 Tax=Acinetobacter ...   225    3e-56 
  UniRef100_E1VFX4 Sensory histidine kinase in two-component regu...   225    4e-56 
  UniRef100_K2GI03 Osmolarity sensor protein EnvZ n=1 Tax=Alcaniv...   225    4e-56 
  UniRef100_K1FE63 GHKL domain protein n=2 Tax=Acinetobacter baum...   225    4e-56 
  UniRef100_N9MTP3 Uncharacterized protein n=1 Tax=Acinetobacter ...   224    4e-56 
  UniRef100_K9BQ99 GHKL domain protein n=1 Tax=Acinetobacter baum...   224    5e-56 
  UniRef100_S6APT1 Two-component histidine kinase EnvZ n=1 Tax=Ps...   224    6e-56 
  UniRef100_I4JQ26 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   224    7e-56 
  UniRef100_F8H651 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   224    8e-56 
  UniRef100_A4VG92 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   224    8e-56 
  UniRef100_A0A009JUI0 HAMP domain protein n=4 Tax=Acinetobacter ...   224    8e-56 
  UniRef100_N9NUE8 Uncharacterized protein n=1 Tax=Acinetobacter ...   224    9e-56 
  UniRef100_F2MVF7 Osmolarity sensor protein EnvZ n=2 Tax=Pseudom...   224    9e-56 
  UniRef100_N2JA29 Uncharacterized protein n=1 Tax=Pseudomonas sp...   223    9e-56 
  UniRef100_A0A011AL49 HAMP domain protein n=2 Tax=Acinetobacter ...   223    1e-55 
  UniRef100_A0A010ZTX0 HAMP domain protein n=1 Tax=Acinetobacter ...   223    1e-55 
  UniRef100_N9B7V4 Uncharacterized protein n=1 Tax=Acinetobacter ...   223    1e-55 
  UniRef100_F9I5Q3 Uncharacterized protein n=1 Tax=Escherichia co...   223    1e-55 
  UniRef100_N9R673 Uncharacterized protein n=1 Tax=Acinetobacter ...   223    1e-55 
  UniRef100_N8PN42 Uncharacterized protein n=2 Tax=Acinetobacter ...   223    1e-55 
  UniRef100_UPI0003B45B2A sensory histidine kinase n=1 Tax=Perluc...   223    1e-55 
  UniRef100_B0VPC8 Sensory histidine kinase in two-component regu...   223    1e-55 
  UniRef100_N8ZJQ3 Uncharacterized protein n=2 Tax=Acinetobacter ...   223    1e-55 
  UniRef100_K6HL12 Sensory histidine kinase in two-component regu...   223    1e-55 
  UniRef100_A0A013Q0U6 HAMP domain protein n=2 Tax=Acinetobacter ...   223    1e-55 
  UniRef100_A0A010CP61 HAMP domain protein n=68 Tax=Acinetobacter...   223    2e-55 
  UniRef100_A0A009JHE9 HAMP domain protein n=1 Tax=Acinetobacter ...   223    2e-55 
  UniRef100_N9M2W1 Uncharacterized protein n=1 Tax=Acinetobacter ...   223    2e-55 
  UniRef100_M8FSS6 Signal transduction histidine kinase n=1 Tax=A...   223    2e-55 
  UniRef100_M2UYS5 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   223    2e-55 
  UniRef100_N9PYQ2 Uncharacterized protein n=1 Tax=Acinetobacter ...   223    2e-55 
  UniRef100_N9A335 Uncharacterized protein n=3 Tax=Acinetobacter ...   223    2e-55 
  UniRef100_A0A010IDB7 HAMP domain protein n=1 Tax=Acinetobacter ...   223    2e-55 
  UniRef100_Q6F7B4 Sensory histidine kinase in two-component regu...   222    2e-55 
  UniRef100_UPI0002D53031 ATPase n=1 Tax=Pseudomonas stutzeri Rep...   222    2e-55 
  UniRef100_I7A530 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   222    2e-55 
  UniRef100_N8W8I1 Uncharacterized protein n=1 Tax=Acinetobacter ...   222    2e-55 
  UniRef100_N9KGL7 Uncharacterized protein n=1 Tax=Acinetobacter ...   222    2e-55 
  UniRef100_UPI0003EDA840 ATPase n=1 Tax=Pseudomonas stutzeri Rep...   222    2e-55 
  UniRef100_N9HB47 Uncharacterized protein n=1 Tax=Acinetobacter ...   222    3e-55 
  UniRef100_L0GP11 Signal transduction histidine kinase n=1 Tax=P...   222    3e-55 
  UniRef100_A0A009YS93 HAMP domain protein n=4 Tax=Acinetobacter ...   222    3e-55 
  UniRef100_A0A013VTW4 HAMP domain protein n=3 Tax=Acinetobacter ...   222    3e-55 
  UniRef100_N9P2S1 Uncharacterized protein n=1 Tax=Acinetobacter ...   221    4e-55 
  UniRef100_W9TNE6 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   221    4e-55 
  UniRef100_N9PTQ1 Uncharacterized protein n=1 Tax=Acinetobacter ...   221    5e-55 
  UniRef100_N8TZP0 Uncharacterized protein n=1 Tax=Acinetobacter ...   221    5e-55 
  UniRef100_N8T168 Uncharacterized protein n=1 Tax=Acinetobacter ...   221    6e-55 
  UniRef100_N9R3D4 Uncharacterized protein n=1 Tax=Acinetobacter ...   221    7e-55 
  UniRef100_N9HHM5 Uncharacterized protein n=2 Tax=Acinetobacter ...   220    9e-55 
  UniRef100_N9KNG7 Uncharacterized protein n=1 Tax=Acinetobacter ...   220    9e-55 
  UniRef100_A0A014UFZ0 HAMP domain protein n=1 Tax=Acinetobacter ...   220    9e-55 
  UniRef100_N8P594 Uncharacterized protein n=1 Tax=Acinetobacter ...   220    1e-54 
  UniRef100_N8TW73 Uncharacterized protein n=1 Tax=Acinetobacter ...   220    1e-54 
  UniRef100_Q0VSY1 Osmolarity sensor protein EnvZ n=2 Tax=Alcaniv...   220    1e-54 
  UniRef100_N9N6T5 Uncharacterized protein n=1 Tax=Acinetobacter ...   220    1e-54 
  UniRef100_N9H8Q1 Uncharacterized protein n=1 Tax=Acinetobacter ...   220    1e-54 
  UniRef100_R9B7I5 Two-component system, OmpR family, osmolarity ...   220    1e-54 
  UniRef100_D0SNK4 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   220    1e-54 
  UniRef100_D0SSS6 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   220    1e-54 
  UniRef100_N9LZX9 Uncharacterized protein n=1 Tax=Acinetobacter ...   219    2e-54 
  UniRef100_UPI000370BAEE sensory histidine kinase n=1 Tax=Acinet...   219    2e-54 
  UniRef100_N9SYD3 Uncharacterized protein n=1 Tax=Acinetobacter ...   219    2e-54 
  UniRef100_N9AXH2 Uncharacterized protein n=1 Tax=Acinetobacter ...   219    2e-54 
  UniRef100_A0A014M169 HAMP domain protein n=1 Tax=Acinetobacter ...   219    2e-54 
  UniRef100_N9TAD3 Uncharacterized protein n=1 Tax=Acinetobacter ...   219    2e-54 
  UniRef100_N8WDR2 Uncharacterized protein n=1 Tax=Acinetobacter ...   219    2e-54 
  UniRef100_N8ZQK7 Uncharacterized protein n=2 Tax=Acinetobacter ...   219    2e-54 
  UniRef100_N8NN13 Uncharacterized protein n=3 Tax=Acinetobacter ...   219    2e-54 
  UniRef100_L0WFY2 Osmolarity sensor protein EnvZ n=1 Tax=Alcaniv...   219    2e-54 
  UniRef100_N9PXK8 Uncharacterized protein n=1 Tax=Acinetobacter ...   219    2e-54 
  UniRef100_A0A013Z175 HAMP domain protein n=1 Tax=Acinetobacter ...   218    3e-54 
  UniRef100_A0A011IHE6 HAMP domain protein n=1 Tax=Acinetobacter ...   218    4e-54 
  UniRef100_N9FLV8 Uncharacterized protein n=1 Tax=Acinetobacter ...   218    4e-54 
  UniRef100_N9ALG8 Uncharacterized protein n=2 Tax=Acinetobacter ...   218    6e-54 
  UniRef100_S3TKA1 Two-component system, OmpR family, osmolarity ...   218    6e-54 
  UniRef100_UPI0002E7F920 ATPase n=1 Tax=Pseudomonas nitroreducen...   218    6e-54 
  UniRef100_A0A009NF06 HAMP domain protein n=1 Tax=Acinetobacter ...   217    7e-54 
  UniRef100_N8ZIM3 Uncharacterized protein n=2 Tax=Acinetobacter ...   217    7e-54 
  UniRef100_N9C7X8 Uncharacterized protein n=1 Tax=Acinetobacter ...   217    7e-54 
  UniRef100_A6VDX5 Two-component sensor EnvZ n=3 Tax=Pseudomonas ...   217    7e-54 
  UniRef100_S3PQJ2 Two-component system, OmpR family, osmolarity ...   217    8e-54 
  UniRef100_L8MS58 Osmolarity sensory histidine kinase EnvZ n=1 T...   217    9e-54 
  UniRef100_A0A010BTV8 HAMP domain protein n=1 Tax=Acinetobacter ...   217    1e-53 
  UniRef100_V2V232 Uncharacterized protein n=1 Tax=Acinetobacter ...   217    1e-53 
  UniRef100_U8DSC7 Two-component system sensor EnvZ n=8 Tax=Pseud...   217    1e-53 
  UniRef100_F9J2W2 Osmolarity sensor protein envZ n=1 Tax=Acineto...   217    1e-53 
  UniRef100_W3KB07 GHKL domain protein n=1 Tax=Acinetobacter baum...   217    1e-53 
  UniRef100_X6X8K6 Two-component system sensor EnvZ n=1 Tax=Pseud...   216    1e-53 
  UniRef100_N9FIG9 Uncharacterized protein n=1 Tax=Acinetobacter ...   216    2e-53 
  UniRef100_F0KGK9 Sensory histidine kinase in two-component regu...   216    2e-53 
  UniRef100_S6KXY1 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   216    2e-53 
  UniRef100_E3A1H8 Two-component sensor EnvZ n=83 Tax=Pseudomonas...   215    3e-53 
  UniRef100_G2L306 Two-component sensor EnvZ n=63 Tax=Pseudomonas...   215    3e-53 
  UniRef100_U8VDX6 Two-component system sensor EnvZ n=1 Tax=Pseud...   215    3e-53 
  UniRef100_I4CYQ6 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   215    3e-53 
  UniRef100_X7ARB5 Two-component system sensor EnvZ n=1 Tax=Pseud...   215    4e-53 
  UniRef100_V4YXV0 ATPase n=1 Tax=Pseudomonas aeruginosa DHS01 Re...   215    4e-53 
  UniRef100_B4X3W9 ATPase, histidine kinase-, DNA gyrase B-, and ...   215    4e-53 
  UniRef100_R9ZL76 ATPase n=1 Tax=Pseudomonas aeruginosa RP73 Rep...   214    4e-53 
  UniRef100_U9KD88 Two-component system sensor EnvZ n=1 Tax=Pseud...   214    5e-53 
  UniRef100_A0A009WUC4 HAMP domain protein n=1 Tax=Acinetobacter ...   214    5e-53 
  UniRef100_U7G0E9 ATPase n=1 Tax=Alcanivorax sp. P2S70 RepID=U7G...   214    6e-53 
  UniRef100_I4ZRX0 Sensory histidine kinase in two-component regu...   214    6e-53 
  UniRef100_W0N1P6 ATPase n=1 Tax=Pseudomonas syringae CC1557 Rep...   214    7e-53 
  UniRef100_B7V3U6 Two-component sensor EnvZ n=7 Tax=Pseudomonas ...   214    8e-53 
  UniRef100_UPI0003B67F61 ATPase n=1 Tax=Pseudomonas caeni RepID=...   214    9e-53 
  UniRef100_F2ZEL3 Osmolarity sensor protein EnvZ n=26 Tax=Pseudo...   214    9e-53 
  UniRef100_Q88AQ7 Osmolarity sensor protein EnvZ n=9 Tax=Pseudom...   213    1e-52 
  UniRef100_N8Z9J9 Uncharacterized protein n=1 Tax=Acinetobacter ...   213    1e-52 
  UniRef100_A0A022ELI6 HAMP domain protein n=1 Tax=Acinetobacter ...   213    1e-52 
  UniRef100_W0HGR2 Sensor histidine kinase n=1 Tax=Pseudomonas ci...   213    1e-52 
  UniRef100_Q48PW7 Osmolarity sensor protein EnvZ n=3 Tax=Pseudom...   213    1e-52 
  UniRef100_I2BVS4 Osmolarity sensor protein EnvZ n=4 Tax=Pseudom...   213    2e-52 
  UniRef100_UPI000307C3C7 ATPase n=1 Tax=Pseudomonas stutzeri Rep...   213    2e-52 
  UniRef100_I4KAF3 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   213    2e-52 
  UniRef100_F3DAD6 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   213    2e-52 
  UniRef100_Q4ZZU0 Osmolarity sensor protein envZ n=3 Tax=Pseudom...   213    2e-52 
  UniRef100_L1M0G6 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   212    3e-52 
  UniRef100_F3EFG9 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   212    3e-52 
  UniRef100_K6ALK7 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   212    3e-52 
  UniRef100_S6I7R9 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   211    4e-52 
  UniRef100_Q3KJQ1 Osmolarity-sensing histidine-kinase n=2 Tax=Ps...   211    4e-52 
  UniRef100_I4KUP2 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   211    4e-52 
  UniRef100_L7H4D9 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   211    5e-52 
  UniRef100_F3GF19 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   211    5e-52 
  UniRef100_J3DSV9 Signal transduction histidine kinase n=2 Tax=P...   211    7e-52 
  UniRef100_S3MAE2 Two-component system osmolarity sensory histid...   211    7e-52 
  UniRef100_UPI00036E3768 ATPase n=1 Tax=Pseudomonas fluorescens ...   211    7e-52 
  UniRef100_K0W9C2 Signal transduction histidine kinase n=2 Tax=P...   211    7e-52 
  UniRef100_U2YZI5 Two-component histidine kinase EnvZ n=1 Tax=Ps...   211    8e-52 
  UniRef100_E2XJV2 Periplasmic sensor signal transduction histidi...   211    8e-52 
  UniRef100_L8N8Z3 Osmolarity sensory histidine kinase EnvZ n=3 T...   210    8e-52 
  UniRef100_F3F098 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   210    9e-52 
  UniRef100_J2MKU6 Signal transduction histidine kinase n=1 Tax=P...   210    1e-51 
  UniRef100_A0A013MVK0 HAMP domain protein n=1 Tax=Acinetobacter ...   210    1e-51 
  UniRef100_M4X4P0 Two-component sensor EnvZ n=1 Tax=Pseudomonas ...   210    1e-51 
  UniRef100_M5QZJ2 Osmolarity sensor protein n=1 Tax=Pseudomonas ...   210    1e-51 
  UniRef100_W6VVM8 Integral membrane sensor signal transduction h...   209    1e-51 
  UniRef100_J3ILY5 Signal transduction histidine kinase n=1 Tax=P...   209    1e-51 
  UniRef100_W8RZ32 ATPase n=1 Tax=Pseudomonas stutzeri RepID=W8RZ...   209    2e-51 
  UniRef100_E7PCE3 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   209    2e-51 
  UniRef100_W8M9Q0 ATPase n=1 Tax=Pseudomonas aeruginosa LESlike7...   209    2e-51 
  UniRef100_J2XM21 Signal transduction histidine kinase n=1 Tax=P...   209    2e-51 
  UniRef100_J2SW20 Signal transduction histidine kinase n=1 Tax=P...   209    2e-51 
  UniRef100_C3KE60 Osmolarity-sensing histidine-kinase n=1 Tax=Ps...   209    3e-51 
  UniRef100_J3ELD1 Signal transduction histidine kinase n=1 Tax=P...   209    3e-51 
  UniRef100_UPI000300EAD5 ATPase n=1 Tax=Pseudomonas fluorescens ...   209    3e-51 
  UniRef100_W8PKW6 ATPase n=1 Tax=Pseudomonas brassicacearum RepI...   209    3e-51 
  UniRef100_UPI0002D46F2F ATPase n=1 Tax=Pseudomonas tolaasii Rep...   208    3e-51 
  UniRef100_J3EDN4 Signal transduction histidine kinase n=1 Tax=P...   208    3e-51 
  UniRef100_UPI00029A0DF7 ATPase n=1 Tax=Pseudomonas mandelii Rep...   208    3e-51 
  UniRef100_H7ES95 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   208    4e-51 
  UniRef100_J2WV15 Signal transduction histidine kinase n=1 Tax=P...   208    4e-51 
  UniRef100_UPI00034ADEC7 ATPase n=1 Tax=Pseudomonas veronii RepI...   208    4e-51 
  UniRef100_V8RFF7 ATPase n=1 Tax=Pseudomonas moraviensis R28-S R...   208    5e-51 
  UniRef100_Q6QGZ8 Osmolarity-sensing histidine-kinase n=1 Tax=Ps...   208    5e-51 
  UniRef100_UPI0002E31CFE ATPase n=1 Tax=Pseudomonas fluorescens ...   208    5e-51 
  UniRef100_J2VBU0 Signal transduction histidine kinase n=1 Tax=P...   207    5e-51 
  UniRef100_U1T662 ATPase n=1 Tax=Pseudomonas fluorescens EGD-AQ6...   207    5e-51 
  UniRef100_W2DW31 Osmolarity-sensing histidine-kinase n=1 Tax=Ps...   207    6e-51 
  UniRef100_S2FV77 Signal transduction histidine kinase n=1 Tax=P...   207    6e-51 
  UniRef100_G8Q0E7 AmgS n=4 Tax=Pseudomonas RepID=G8Q0E7_PSEFL         207    7e-51 
  UniRef100_UPI00029A3B44 ATPase n=1 Tax=Pseudomonas sp. R81 RepI...   207    7e-51 
  UniRef100_UPI00036D1E92 ATPase n=1 Tax=Pseudomonas mandelii Rep...   207    7e-51 
  UniRef100_A0A023C544 ATPase n=1 Tax=Pseudomonas extremaustralis...   207    7e-51 
  UniRef100_S6H9D6 Osmolarity sensor protein envZ n=1 Tax=Pseudom...   207    8e-51 
  UniRef100_J2YCK9 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   207    8e-51 
  UniRef100_F3HDM5 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   207    9e-51 
  UniRef100_U3HVQ5 ATPase n=1 Tax=Pseudomonas stutzeri MF28 RepID...   207    9e-51 
  UniRef100_J2RJY4 Signal transduction histidine kinase n=1 Tax=P...   207    9e-51 
  UniRef100_J3GCN9 Signal transduction histidine kinase n=1 Tax=P...   207    1e-50 
  UniRef100_UPI000289E31D ATPase n=1 Tax=Pseudomonas fuscovaginae...   207    1e-50 
  UniRef100_J2YVK6 Signal transduction histidine kinase n=1 Tax=P...   206    1e-50 
  UniRef100_S6SBM0 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   206    1e-50 
  UniRef100_UPI00034C5CA0 ATPase n=1 Tax=Pseudomonas sp. CBZ-4 Re...   206    1e-50 
  UniRef100_UPI00030DC725 ATPase n=1 Tax=Pseudomonas psychrophila...   206    1e-50 
  UniRef100_I4MZ71 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   206    1e-50 
  UniRef100_D7HUW4 Osmolarity sensory histidine kinase EnvZ n=1 T...   206    2e-50 
  UniRef100_U7D994 ATPase n=1 Tax=Pseudomonas fluorescens NCIMB 1...   206    2e-50 
  UniRef100_V9QPP9 ATPase n=1 Tax=Pseudomonas sp. TKP RepID=V9QPP...   206    2e-50 
  UniRef100_K9NCA3 Osmolarity sensor protein n=1 Tax=Pseudomonas ...   206    2e-50 
  UniRef100_L0WKA2 Two-component system sensor histidine kinase n...   206    2e-50 
  UniRef100_J3GYY6 Signal transduction histidine kinase n=2 Tax=P...   206    2e-50 
  UniRef100_UPI00031141A7 ATPase n=1 Tax=Pseudomonas fluorescens ...   206    3e-50 
  UniRef100_D5VAF6 Two-component system sensor histidine kinase n...   205    3e-50 
  UniRef100_A0A010T0G8 ATPase n=1 Tax=Pseudomonas fluorescens HK4...   205    3e-50 
  UniRef100_S6I1Y6 Osmolarity-sensing histidine-kinase n=1 Tax=Ps...   205    4e-50 
  UniRef100_J0PDV6 Osmolarity-sensing histidine-kinase n=2 Tax=Ps...   205    4e-50 
  UniRef100_UPI00030AC0D1 ATPase n=1 Tax=Pseudomonas sp. PAMC 267...   204    5e-50 
  UniRef100_W2DQB8 Osmolarity-sensing histidine-kinase n=1 Tax=Ps...   204    5e-50 
  UniRef100_UPI0002DDD197 ATPase n=1 Tax=Pseudomonas fragi RepID=...   204    6e-50 
  UniRef100_J3GS92 Signal transduction histidine kinase n=1 Tax=P...   204    7e-50 
  UniRef100_S6IML9 Putative osmolarity sensor protein EnvZ n=1 Ta...   202    2e-49 
  UniRef100_M4KCP5 Osmolarity-sensing histidine-kinase n=2 Tax=Ps...   202    2e-49 
  UniRef100_V8D8G7 ATPase n=1 Tax=Pseudomonas chlororaphis subsp....   202    2e-49 
  UniRef100_Q4KK10 Osmolarity sensor protein EnvZ n=3 Tax=Pseudom...   202    3e-49 
  UniRef100_UPI0002556F33 ATPase n=1 Tax=Pseudomonas sp. S9 RepID...   202    3e-49 
  UniRef100_J2N044 Signal transduction histidine kinase n=1 Tax=P...   201    4e-49 
  UniRef100_U6ZLN2 ATPase n=1 Tax=Pseudomonas sp. CMAA1215 RepID=...   201    5e-49 
  UniRef100_I4XND5 Osmolarity sensor protein EnvZ n=2 Tax=Pseudom...   201    5e-49 
  UniRef100_F6AJ36 Integral membrane sensor signal transduction h...   200    1e-48 
  UniRef100_UPI00035FA3F6 hypothetical protein n=1 Tax=Gallionell...   199    2e-48 
  UniRef100_UPI000309E50A ATPase n=1 Tax=Pseudomonas agarici RepI...   199    2e-48 
  UniRef100_A5WBW7 Integral membrane sensor signal transduction h...   199    2e-48 
  UniRef100_Q1Q8A3 Histidine kinase n=1 Tax=Psychrobacter cryohal...   199    2e-48 
  UniRef100_S4Z0D2 Sensory histidine kinase n=1 Tax=Psychrobacter...   199    2e-48 
  UniRef100_E4QKR5 Histidine kinase n=1 Tax=Methylovorus sp. (str...   197    1e-47 
  UniRef100_C6X790 Histidine kinase n=1 Tax=Methylovorus glucoset...   196    1e-47 
  UniRef100_Q1IGK7 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   196    2e-47 
  UniRef100_G8QLX0 Signal transduction histidine kinase n=1 Tax=A...   196    2e-47 
  UniRef100_UPI000375C91D sensory histidine kinase n=1 Tax=Psychr...   196    2e-47 
  UniRef100_K0IAE4 Periplasmic sensory histidine protein kinase n...   196    2e-47 
  UniRef100_UPI00036547B7 ATPase n=1 Tax=Pseudomonas thermotolera...   195    3e-47 
  UniRef100_UPI0003660BF7 MULTISPECIES: hypothetical protein n=1 ...   195    4e-47 
  UniRef100_T6TW60 Osmolarity sensor protein envZ n=2 Tax=Escheri...   194    5e-47 
  UniRef100_UPI00029AE134 ATPase n=1 Tax=Pseudomonas sp. HYS RepI...   194    5e-47 
  UniRef100_UPI0003767782 hypothetical protein n=1 Tax=Methylophi...   194    6e-47 
  UniRef100_UPI000289D6AB sensory histidine kinase n=1 Tax=Psychr...   194    7e-47 
  UniRef100_Q1H3L4 Histidine kinase n=1 Tax=Methylobacillus flage...   193    1e-46 
  UniRef100_UPI00037DEFA0 histidine kinase n=1 Tax=Bordetella sp....   193    1e-46 
  UniRef100_U5VPF2 Integral membrane sensor signal transduction h...   193    1e-46 
  UniRef100_F8UGY9 Signal transduction histidine kinase core prot...   193    1e-46 
  UniRef100_Q47EK6 ATP-binding region, ATPase-like:Histidine kina...   192    3e-46 
  UniRef100_F8FX23 Integral membrane sensor signal transduction h...   192    3e-46 
  UniRef100_C6WXW7 Histidine kinase n=1 Tax=Methylotenera mobilis...   192    3e-46 
  UniRef100_Q4FQ41 Probable signal transduction histidine kinase ...   192    4e-46 
  UniRef100_B0KHZ9 Integral membrane sensor signal transduction h...   191    4e-46 
  UniRef100_F5SQ12 Sensor histidine kinase n=1 Tax=Psychrobacter ...   191    7e-46 
  UniRef100_U4TEN0 Osmolarity sensory histidine kinase EnvZ n=1 T...   191    8e-46 
  UniRef100_UPI0002E43E73 ATPase n=1 Tax=Pseudomonas sp. S13.1.2 ...   191    9e-46 
  UniRef100_R9UXS2 ATPase n=2 Tax=Pseudomonas putida RepID=R9UXS2...   190    1e-45 
  UniRef100_UPI0003803756 hypothetical protein n=1 Tax=Methyloten...   190    1e-45 
  UniRef100_T2H047 Two-component histidine kinase EnvZ n=1 Tax=Ps...   190    1e-45 
  UniRef100_Y0KJ97 Signal transduction histidine kinase n=1 Tax=M...   190    1e-45 
  UniRef100_S6X0T3 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   189    2e-45 
  UniRef100_A5VX26 Osmolarity sensor protein envZ n=6 Tax=Pseudom...   189    2e-45 
  UniRef100_UPI0002DEC425 sensor histidine kinase n=1 Tax=Cupriav...   189    2e-45 
  UniRef100_UPI0003781C81 histidine kinase n=2 Tax=Methylotenera ...   189    2e-45 
  UniRef100_U2SM48 ATPase n=1 Tax=Pseudomonas putida LF54 RepID=U...   189    2e-45 
  UniRef100_S2KH04 EnvZ protein n=1 Tax=Pseudomonas plecoglossici...   188    3e-45 
  UniRef100_Q1LLZ9 Sensory histidine kinase in two-component regu...   188    4e-45 
  UniRef100_Q2KUW0 Two component system sensor kinase n=1 Tax=Bor...   188    5e-45 
  UniRef100_UPI0003664C6E hypothetical protein n=1 Tax=Methylover...   187    6e-45 
  UniRef100_F0E0Z1 Integral membrane sensor signal transduction h...   187    6e-45 
  UniRef100_L2EAD0 Sensory histidine kinase in two-component regu...   187    7e-45 
  UniRef100_X0QEK5 Osmolarity sensory histidine kinase EnvZ n=1 T...   187    8e-45 
  UniRef100_E4RBY6 EnvZ n=2 Tax=Pseudomonas putida RepID=E4RBY6_P...   187    1e-44 
  UniRef100_B1JES0 Integral membrane sensor signal transduction h...   186    1e-44 
  UniRef100_B1G1A5 Integral membrane sensor signal transduction h...   185    3e-44 
  UniRef100_D4X8Y7 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   185    4e-44 
  UniRef100_V6J345 HAMP domain protein n=1 Tax=Pseudomonas putida...   184    6e-44 
  UniRef100_UPI000310E592 MULTISPECIES: ATPase n=1 Tax=Pseudomona...   184    7e-44 
  UniRef100_H0PSV1 Sensor histidine kinase n=1 Tax=Azoarcus sp. K...   184    8e-44 
  UniRef100_H0F271 RisS protein n=1 Tax=Achromobacter arsenitoxyd...   184    8e-44 
  UniRef100_R4XN25 Osmolarity sensory histidine kinase EnvZ n=2 T...   184    9e-44 
  UniRef100_F7T3J1 RisS protein n=1 Tax=Achromobacter xylosoxidan...   184    9e-44 
  UniRef100_X0RAZ4 Osmolarity sensory histidine kinase EnvZ n=1 T...   184    1e-43 
  UniRef100_V9RT04 Osmolarity sensory histidine kinase EnvZ n=1 T...   183    1e-43 
  UniRef100_B1JTW7 Histidine kinase n=1 Tax=Burkholderia cenocepa...   183    1e-43 
  UniRef100_T1XBQ8 Two component transcriptional regulator, senso...   183    1e-43 
  UniRef100_UPI000365B1F6 histidine kinase n=1 Tax=Methylotenera ...   183    1e-43 
  UniRef100_G7HE76 Osmolarity sensory histidine kinase EnvZ n=4 T...   183    1e-43 
  UniRef100_A0K863 Periplasmic sensor signal transduction histidi...   183    1e-43 
  UniRef100_K0M9S0 Sensor kinase protein n=12 Tax=Bordetella RepI...   183    1e-43 
  UniRef100_O88102 RisS protein n=2 Tax=Bordetella RepID=O88102_B...   183    1e-43 
  UniRef100_UPI00035D2500 hypothetical protein n=1 Tax=Moraxella ...   183    2e-43 
  UniRef100_Q39FC2 Periplasmic sensor signal transduction histidi...   183    2e-43 
  UniRef100_V5UMS1 Sensor histidine kinase n=2 Tax=Pandoraea RepI...   182    2e-43 
  UniRef100_A0A011Q171 Osmolarity sensor protein EnvZ n=1 Tax=Can...   182    2e-43 
  UniRef100_S9ZUB3 Uncharacterized protein n=1 Tax=Thauera terpen...   182    3e-43 
  UniRef100_A0A022GE84 Histidine kinase n=1 Tax=Cupriavidus sp. S...   182    3e-43 
  UniRef100_X0R6Q5 Osmolarity sensory histidine kinase EnvZ n=1 T...   182    3e-43 
  UniRef100_F0G9I4 Putative oxidative stress related two-componen...   182    3e-43 
  UniRef100_C1DJI1 Osmolarity-sensing histidine protein kinase, E...   182    3e-43 
  UniRef100_V5PQR8 Sensor histidine kinase n=1 Tax=Pandoraea pnom...   181    4e-43 
  UniRef100_J3IRF5 Signal transduction histidine kinase n=1 Tax=P...   181    4e-43 
  UniRef100_UPI000373532C sensor histidine kinase n=1 Tax=Pseudom...   181    5e-43 
  UniRef100_C8PWV6 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   181    5e-43 
  UniRef100_N6YDJ2 Osmolarity sensor protein n=1 Tax=Thauera sp. ...   181    5e-43 
  UniRef100_J4QUY5 RisS protein n=1 Tax=Achromobacter piechaudii ...   181    6e-43 
  UniRef100_E3HS27 RisS protein n=1 Tax=Achromobacter xylosoxidan...   181    6e-43 
  UniRef100_R7WTY7 Sensor histidine kinase RisS n=1 Tax=Pandoraea...   181    9e-43 
  UniRef100_I2DN73 Osmolarity sensory histidine kinase EnvZ n=1 T...   180    1e-42 
  UniRef100_N6YUT5 Osmolarity sensor protein n=1 Tax=Thauera lina...   180    1e-42 
  UniRef100_UPI00016A6B02 sensor histidine kinase n=1 Tax=Burkhol...   180    1e-42 
  UniRef100_A2W9I5 Signal transduction histidine kinase n=1 Tax=B...   180    1e-42 
  UniRef100_A4JF16 Integral membrane sensor signal transduction h...   179    2e-42 
  UniRef100_U2H9X0 Osmolarity sensory histidine kinase EnvZ n=1 T...   179    2e-42 
  UniRef100_C0AUF3 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   179    2e-42 
  UniRef100_A0A011QGY6 Osmolarity sensor protein EnvZ n=1 Tax=Can...   179    2e-42 
  UniRef100_K8R1B2 Integral membrane sensor signal transduction h...   179    2e-42 
  UniRef100_A9II54 RisS protein n=1 Tax=Bordetella petrii (strain...   179    2e-42 
  UniRef100_Q1LGH6 Periplasmic sensor signal transduction histidi...   179    3e-42 
  UniRef100_UPI00037520FB hypothetical protein n=1 Tax=Rhodocycla...   179    3e-42 
  UniRef100_UPI000375F5BC hypothetical protein n=1 Tax=Burkholder...   179    3e-42 
  UniRef100_W8WUX6 Osmolarity sensory histidine kinase EnvZ n=1 T...   178    4e-42 
  UniRef100_B1YS07 Integral membrane sensor signal transduction h...   178    5e-42 
  UniRef100_UPI0002FE8ED3 histidine kinase n=1 Tax=Cupriavidus sp...   177    6e-42 
  UniRef100_C4ZK08 Histidine kinase n=3 Tax=Thauera RepID=C4ZK08_...   177    6e-42 
  UniRef100_U3QV48 Histidine kinase n=1 Tax=Ralstonia pickettii D...   177    7e-42 
  UniRef100_C5AF79 Putative oxidative stress related two componen...   177    7e-42 
  UniRef100_J7J9G3 Periplasmic sensor signal transduction histidi...   177    7e-42 
  UniRef100_C1DIU2 Periplasmic sensory histidine protein kinase n...   177    7e-42 
  UniRef100_Q0BEE0 Periplasmic sensor signal transduction histidi...   177    8e-42 
  UniRef100_UPI00036461AA sensor histidine kinase n=1 Tax=Burkhol...   177    1e-41 
  UniRef100_A9AIT9 Integral membrane sensor signal transduction h...   177    1e-41 
  UniRef100_Q476B0 ATP-binding region, ATPase-like:Histidine kina...   176    1e-41 
  UniRef100_B9C0N7 RisS protein n=3 Tax=Burkholderia multivorans ...   176    1e-41 
  UniRef100_F2LEM1 Putative oxidative stress related two componen...   176    2e-41 
  UniRef100_J1QPN2 HAMP domain protein n=1 Tax=Kosakonia radicinc...   176    2e-41 
  UniRef100_W6BZ74 Putative oxidative stress related two componen...   176    2e-41 
  UniRef100_A4XP67 Osmolarity sensor protein envZ n=2 Tax=Pseudom...   176    2e-41 
  UniRef100_N6YNG5 Histidine kinase n=1 Tax=Thauera phenylacetica...   176    2e-41 
  UniRef100_B1TBK2 Integral membrane sensor signal transduction h...   176    2e-41 
  UniRef100_UPI00036DDC2A hypothetical protein n=1 Tax=Methylover...   176    2e-41 
  UniRef100_J5BFS9 GHKL domain protein n=1 Tax=Burkholderia multi...   176    2e-41 
  UniRef100_B2T3X5 Integral membrane sensor signal transduction h...   176    3e-41 
  UniRef100_B9BEJ1 RisS protein n=1 Tax=Burkholderia multivorans ...   176    3e-41 
  UniRef100_UPI0002F93CFA histidine kinase n=1 Tax=Pusillimonas n...   175    3e-41 
  UniRef100_W6BWR4 Putative oxidative stress related two componen...   175    3e-41 
  UniRef100_Q2SWT2 Sensor histidine kinase RisS n=1 Tax=Burkholde...   175    3e-41 
  UniRef100_D7DKQ4 Integral membrane sensor signal transduction h...   175    3e-41 
  UniRef100_UPI00034C6E32 hypothetical protein n=1 Tax=Burkholder...   175    4e-41 
  UniRef100_I2IKR3 Signal transduction histidine kinase n=2 Tax=B...   175    4e-41 
  UniRef100_V2HBP6 Sensor histidine kinase n=1 Tax=Cupriavidus sp...   175    4e-41 
  UniRef100_UPI00034C7BD8 hypothetical protein n=1 Tax=Pandoraea ...   175    4e-41 
  UniRef100_E1T7D0 Integral membrane sensor signal transduction h...   175    5e-41 
  UniRef100_B1FFN7 Integral membrane sensor signal transduction h...   174    5e-41 
  UniRef100_Q5NYM7 Sensor histidine kinase n=1 Tax=Aromatoleum ar...   174    5e-41 
  UniRef100_K1JXD1 Uncharacterized protein n=1 Tax=Sutterella wad...   174    5e-41 
  UniRef100_UPI00034A6631 sensor histidine kinase n=1 Tax=Burkhol...   174    5e-41 
  UniRef100_X4ZHT0 Putative oxidative stress related two componen...   174    6e-41 
  UniRef100_W6B0U3 Putative oxidative stress related two componen...   174    7e-41 
  UniRef100_B2TFS8 Integral membrane sensor signal transduction h...   174    8e-41 
  UniRef100_I5CQM7 Integral membrane sensor signal transduction h...   174    8e-41 
  UniRef100_UPI00016A69FD sensor histidine kinase n=1 Tax=Burkhol...   174    8e-41 
  UniRef100_W4NNG1 Osmolarity sensory histidine kinase EnvZ n=1 T...   174    9e-41 
  UniRef100_L2F980 Integral membrane sensor signal transduction h...   174    9e-41 
  UniRef100_B5WRN1 Integral membrane sensor signal transduction h...   174    1e-40 
  UniRef100_Q472E6 ATP-binding region, ATPase-like:Histidine kina...   173    1e-40 
  UniRef100_I6AIN5 Sensor histidine kinase RisS n=1 Tax=Burkholde...   173    2e-40 
  UniRef100_E5ARI5 Osmolarity sensor protein envZ (EC 2.7.3.-) n=...   173    2e-40 
  UniRef100_A3MKL9 Sensor histidine kinase RisS n=7 Tax=pseudomal...   173    2e-40 
  UniRef100_N0AFE2 Putative oxidative stress related two componen...   173    2e-40 
  UniRef100_UPI00037F49BA sensor histidine kinase n=1 Tax=Burkhol...   172    2e-40 
  UniRef100_A3NAL4 Sensor histidine kinase RisS n=1 Tax=Burkholde...   172    2e-40 
  UniRef100_I1WI55 Sensor histidine kinase RisS n=18 Tax=Burkhold...   172    2e-40 
  UniRef100_A1V4Z4 Sensor histidine kinase RisS n=4 Tax=Burkholde...   172    2e-40 
  UniRef100_E8YP06 Integral membrane sensor signal transduction h...   172    2e-40 
  UniRef100_K0DPK7 Two-component system, OmpR family, osmolarity ...   172    3e-40 
  UniRef100_A3NWD5 Sensor histidine kinase RisS n=11 Tax=Burkhold...   172    3e-40 
  UniRef100_L2EFQ4 Periplasmic sensor signal transduction histidi...   172    3e-40 
  UniRef100_D6CSU9 Putative two-component sensor histidine kinase...   172    3e-40 
  UniRef100_B1FZ11 Integral membrane sensor signal transduction h...   172    3e-40 
  UniRef100_I0KK94 Sensory histidine kinase in two-component regu...   172    3e-40 
  UniRef100_V6UTD7 ATPase (Fragment) n=1 Tax=Pseudomonas mosselii...   171    4e-40 
  UniRef100_E8YTH4 Integral membrane sensor signal transduction h...   171    5e-40 
  UniRef100_D5W7X6 Integral membrane sensor signal transduction h...   171    5e-40 
  UniRef100_N6ZDB0 Histidine kinase n=1 Tax=Thauera sp. 28 RepID=...   171    5e-40 
  UniRef100_UPI00036781B2 sensor histidine kinase n=1 Tax=Burkhol...   171    6e-40 
  UniRef100_D5X0V6 Integral membrane sensor signal transduction h...   171    6e-40 
  UniRef100_B2JGK6 Integral membrane sensor signal transduction h...   171    6e-40 
  UniRef100_K0DZ53 Two-component system, OmpR family, osmolarity ...   171    8e-40 
  UniRef100_F5RA94 Sensor protein n=1 Tax=Methyloversatilis unive...   171    8e-40 
  UniRef100_E6PSJ9 Putative two-component sensor histidine kinase...   170    1e-39 
  UniRef100_U2BBD0 ATPase (Fragment) n=1 Tax=Pseudomonas sp. EGD-...   170    1e-39 
  UniRef100_N6YQ77 Histidine kinase n=1 Tax=Thauera sp. 27 RepID=...   170    1e-39 
  UniRef100_UPI0002559F2E histidine kinase n=1 Tax=Oceanicola sp....   170    1e-39 
  UniRef100_UPI00016A6380 sensor histidine kinase n=1 Tax=Burkhol...   170    1e-39 
  UniRef100_A3K9P3 Sensor histidine kinase n=1 Tax=Sagittula stel...   170    1e-39 
  UniRef100_UPI0002F5902B ATPase n=1 Tax=Pseudomonas alcaliphila ...   170    1e-39 
  UniRef100_U1U8Z8 ATPase n=1 Tax=Pseudomonas mendocina EGD-AQ5 R...   170    1e-39 
  UniRef100_I2IS09 Signal transduction histidine kinase n=1 Tax=B...   170    2e-39 
  UniRef100_Q398U0 Periplasmic sensor signal transduction histidi...   169    2e-39 
  UniRef100_F6G1G1 Oxidative stress resistance two-component tran...   169    2e-39 
  UniRef100_R4WW70 Integral membrane sensor signal transduction h...   169    2e-39 
  UniRef100_R6AHA5 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   169    2e-39 
  UniRef100_B9Z5B6 Integral membrane sensor signal transduction h...   169    2e-39 
  UniRef100_G2IUD7 Integral membrane sensor signal transduction h...   169    3e-39 
  UniRef100_H1RXX8 Signal transduction histidine kinase n=1 Tax=C...   169    3e-39 
  UniRef100_G3A7F2 Sensory histidine kinase in two-component regu...   169    3e-39 
  UniRef100_UPI0002F6C893 hypothetical protein n=1 Tax=Herbaspiri...   169    3e-39 
  UniRef100_UPI00036CF0BA sensor histidine kinase n=1 Tax=Cupriav...   169    3e-39 
  UniRef100_UPI00037DB1E9 sensor histidine kinase n=1 Tax=Cupriav...   169    3e-39 
  UniRef100_F4DZM2 Osmolarity sensor protein EnvZ n=1 Tax=Pseudom...   169    3e-39 
  UniRef100_D8NIS5 Sensory histidine kinase in two-component regu...   169    3e-39 
  UniRef100_B5SKC0 Oxidative stress resistance two-component tran...   169    3e-39 
  UniRef100_Q13PR0 Periplasmic sensor signal transduction histidi...   168    4e-39 
  UniRef100_W6RAM3 Histidine kinase n=1 Tax=Pseudomonas pseudoalc...   168    4e-39 
  UniRef100_Q8XYV9 Probable oxidative stress resistance two-compo...   168    4e-39 
  UniRef100_UPI00036FFFDC hypothetical protein n=1 Tax=Uliginosib...   168    5e-39 
  UniRef100_A0A022H103 Histidine kinase n=1 Tax=Cupriavidus sp. S...   168    5e-39 
  UniRef100_R5E7I1 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   168    6e-39 
  UniRef100_G2ZLM2 Sensory histidine kinase in two-component regu...   168    6e-39 
  UniRef100_M4UCS2 Osmolarity sensory histidine kinase EnvZ n=2 T...   167    7e-39 
  UniRef100_I9W5Q6 Oxidative stress resistance two-component tran...   167    7e-39 
  UniRef100_Q13XG7 Periplasmic sensor signal transduction Histidi...   167    7e-39 
  UniRef100_B9TH06 Sensory transduction histidine kinase, putativ...   167    7e-39 
  UniRef100_UPI0002D56B1E sensor histidine kinase n=1 Tax=Ralston...   167    8e-39 
  UniRef100_Q0ARM9 Periplasmic sensor signal transduction histidi...   167    8e-39 
  UniRef100_X7FAL1 Histidine kinase n=1 Tax=Roseivivax isoporae L...   167    9e-39 
  UniRef100_UPI00037FF2AD hypothetical protein n=1 Tax=Amorphus c...   167    1e-38 
  UniRef100_F9UDL9 Integral membrane sensor signal transduction h...   167    1e-38 
  UniRef100_J0UAQ1 Signal transduction histidine kinase n=1 Tax=A...   167    1e-38 
  UniRef100_L0DSA8 Periplasmic Sensor Signal Transduction Histidi...   166    1e-38 
  UniRef100_Q0G3M6 Probable two-component sensor n=1 Tax=Fulvimar...   166    1e-38 
  UniRef100_A4EL13 Signal transduction kinase protein n=1 Tax=Ros...   166    2e-38 
  UniRef100_D8NBL2 Sensory histidine kinase in two-component regu...   166    2e-38 
  UniRef100_A1K670 Probable osmolarity sensor protein n=1 Tax=Azo...   166    2e-38 
  UniRef100_UPI00036A6567 ATPase n=1 Tax=Pseudomonas mendocina Re...   166    2e-38 
  UniRef100_W0SI04 Osmolarity sensor protein n=1 Tax=Sulfuritalea...   166    2e-38 
  UniRef100_G7USU5 Two-component system sensory histidine kinase ...   166    2e-38 
  UniRef100_UPI00036F5044 sensor histidine kinase n=1 Tax=Cupriav...   166    2e-38 
  UniRef100_UPI00037A2F7F hypothetical protein n=1 Tax=Methylover...   166    2e-38 
  UniRef100_F8ETM0 Integral membrane sensor signal transduction h...   166    2e-38 
  UniRef100_W0DH20 Histidine kinase n=1 Tax=Thioalkalivibrio thio...   166    2e-38 
  UniRef100_B3R4U9 Sensory histidine kinase in two-component regu...   166    2e-38 
  UniRef100_E1TDT6 Integral membrane sensor signal transduction h...   166    3e-38 
  UniRef100_UPI00037F29E9 hypothetical protein n=1 Tax=Thioalkali...   166    3e-38 
  UniRef100_D8NTE9 Sensory histidine kinase in two-component regu...   165    3e-38 
  UniRef100_Q2W9X3 Signal transduction histidine kinase n=1 Tax=M...   165    4e-38 
  UniRef100_K8RD37 Integral membrane sensor signal transduction h...   165    4e-38 
  UniRef100_Q0KBM4 Signal transduction histidine kinase n=2 Tax=B...   165    4e-38 
  UniRef100_G2JAG8 Sensor protein n=1 Tax=Candidatus Glomeribacte...   165    5e-38 
  UniRef100_G0ETK9 Osmolarity sensor protein EnvZ n=1 Tax=Cupriav...   164    5e-38 
  UniRef100_R4WY59 Integral membrane sensor signal transduction h...   164    6e-38 
  UniRef100_A0A022GAS6 Histidine kinase n=1 Tax=Cupriavidus sp. S...   164    6e-38 
  UniRef100_V4T9L3 Osmolarity sensor protein EnvZ n=1 Tax=Lutibac...   164    7e-38 
  UniRef100_X7EHY2 Histidine kinase n=1 Tax=Roseivivax halodurans...   164    7e-38 
  UniRef100_A0A014NYX3 Histidine kinase n=1 Tax=Comamonas aquatic...   164    7e-38 
  UniRef100_UPI000375F493 hypothetical protein n=1 Tax=Thioalkali...   164    7e-38 
  UniRef100_U3QFY2 Sensor histidine kinase n=1 Tax=Ralstonia pick...   164    7e-38 
  UniRef100_X6KT75 Histidine kinase n=1 Tax=Rhodobacteraceae bact...   163    2e-37 
  UniRef100_F4GMJ0 Uncharacterized protein n=1 Tax=Pusillimonas s...   163    2e-37 
  UniRef100_E7H424 Uncharacterized protein n=1 Tax=Sutterella wad...   163    2e-37 
  UniRef100_G1XXX8 Signal transduction histidine kinase n=1 Tax=A...   163    2e-37 
  UniRef100_U7GA61 Histidine kinase n=2 Tax=Labrenzia RepID=U7GA6...   162    2e-37 
  UniRef100_S9QH69 Sensor histidine kinase n=1 Tax=Thalassobacter...   162    2e-37 
  UniRef100_S3BL59 Uncharacterized protein n=1 Tax=Sutterella wad...   162    2e-37 
  UniRef100_A0P2F5 Sensor histidine kinase n=1 Tax=Labrenzia aggr...   162    2e-37 
  UniRef100_U2MHT0 ATP-binding region n=1 Tax=Pantoea sp. AS-PWVM...   162    2e-37 
  UniRef100_S9TGY1 Sensor histidine kinase n=1 Tax=Ralstonia sp. ...   162    2e-37 
  UniRef100_I5CKW6 Integral membrane sensor signal transduction h...   162    2e-37 
  UniRef100_D0CPZ0 Sensor histidine kinase n=1 Tax=Silicibacter l...   162    2e-37 
  UniRef100_A0A022FXI3 Histidine kinase n=1 Tax=Cupriavidus sp. S...   162    2e-37 
  UniRef100_R5PYA7 Uncharacterized protein n=1 Tax=Sutterella wad...   162    3e-37 
  UniRef100_G8MFF4 Integral membrane sensor signal transduction h...   162    3e-37 
  UniRef100_W6WMX8 Integral membrane sensor signal transduction h...   162    3e-37 
  UniRef100_D5WGG6 Integral membrane sensor signal transduction h...   162    3e-37 
  UniRef100_W0TJ18 Two-component system OmpR family osmolarity se...   162    4e-37 
  UniRef100_R7BZT7 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   162    4e-37 
  UniRef100_UPI0003B75082 ATPase n=1 Tax=Pelagibacter ubique RepI...   162    4e-37 
  UniRef100_V4P0I3 Uncharacterized protein n=1 Tax=Asticcacaulis ...   162    4e-37 
  UniRef100_A0A023D3B7 Two component sensor histidine kinase EnvZ...   161    4e-37 
  UniRef100_Q1LR24 Sensor histidine kinase in two-component regul...   161    5e-37 
  UniRef100_UPI00035F6EE5 histidine kinase n=1 Tax=Burkholderia s...   161    5e-37 
  UniRef100_UPI000347364F ATPase n=1 Tax=Rhodopseudomonas sp. B29...   161    5e-37 
  UniRef100_Q6N1N8 Sensor histidine kinase n=1 Tax=Rhodopseudomon...   161    6e-37 
  UniRef100_UPI000362CD9F hypothetical protein n=1 Tax=Massilia n...   161    6e-37 
  UniRef100_W4NCD2 Signal transduction histidine kinase n=1 Tax=B...   161    6e-37 
  UniRef100_UPI000380D4B4 hypothetical protein n=1 Tax=Azoarcus t...   161    7e-37 
  UniRef100_B6BWN5 Osmolarity sensor protein EnvZ, putative n=1 T...   161    7e-37 
  UniRef100_E6VC81 Integral membrane sensor signal transduction h...   161    7e-37 
  UniRef100_Q1QIS5 Signal transduction histidine kinase n=1 Tax=N...   161    7e-37 
  UniRef100_B3RCL2 Sensory histidine kinase in two-component regu...   160    7e-37 
  UniRef100_L2EIS3 Sensor histidine kinase in two-component regul...   160    8e-37 
  UniRef100_UPI00035CDF9E hypothetical protein n=1 Tax=alpha prot...   160    9e-37 
  UniRef100_A0P5W1 ATP-binding region, ATPase-like:Histidine kina...   160    9e-37 
  UniRef100_B3Q7Y5 Integral membrane sensor signal transduction h...   160    9e-37 
  UniRef100_Q5LRF6 Sensor histidine kinase n=1 Tax=Ruegeria pomer...   160    1e-36 
  UniRef100_U3AM94 Osmolarity sensor protein EnvZ n=1 Tax=Brevund...   160    1e-36 
  UniRef100_E2T3L5 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   160    1e-36 
  UniRef100_G8M8Y3 Integral membrane sensor signal transduction h...   160    1e-36 
  UniRef100_C6BIT1 Histidine kinase n=1 Tax=Ralstonia pickettii (...   160    1e-36 
  UniRef100_I6AF22 Periplasmic sensor signal transduction Histidi...   160    1e-36 
  UniRef100_Q475H7 ATP-binding region, ATPase-like:Histidine kina...   160    2e-36 
  UniRef100_K2IFQ8 Sensor histidine kinase n=1 Tax=Oceanibaculum ...   159    2e-36 
  UniRef100_I1B2G9 Sensor histidine kinase, putative n=1 Tax=Citr...   159    2e-36 
  UniRef100_UPI00035C4888 histidine kinase n=1 Tax=Burkholderia s...   159    2e-36 
  UniRef100_Q2CEQ9 Signal transduction kinase protein n=1 Tax=Oce...   159    2e-36 
  UniRef100_Q219I9 Signal transduction histidine kinase n=1 Tax=R...   159    2e-36 
  UniRef100_V4PEF5 Histidine kinase n=1 Tax=Asticcacaulis beneves...   159    2e-36 
  UniRef100_UPI000237A630 histidine kinase n=1 Tax=Ruegeria conch...   159    2e-36 
  UniRef100_J7JFE6 Periplasmic sensor signal transduction histidi...   159    2e-36 
  UniRef100_B9NQW9 Sensor histidine kinase n=1 Tax=Rhodobacterace...   159    2e-36 
  UniRef100_H3KE11 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   159    2e-36 
  UniRef100_Q28RB2 Periplasmic sensor signal transduction histidi...   159    2e-36 
  UniRef100_UPI000364FCD5 hypothetical protein n=1 Tax=Wenxinia m...   159    2e-36 
  UniRef100_A3V5T7 Sensor histidine kinase n=1 Tax=Loktanella ves...   159    3e-36 
  UniRef100_UPI0001911B4F histidine kinase, partial n=1 Tax=Salmo...   159    3e-36 
  UniRef100_R7IJE4 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   159    3e-36 
  UniRef100_S9Q854 Sensor histidine kinase n=1 Tax=Salipiger muco...   159    3e-36 
  UniRef100_C3X1L5 Uncharacterized protein n=1 Tax=Oxalobacter fo...   159    3e-36 
  UniRef100_B2UFT3 Integral membrane sensor signal transduction h...   159    3e-36 
  UniRef100_K2LSX0 Two-component system sensor histidine kinase n...   159    3e-36 
  UniRef100_UPI0002E4FDC4 histidine kinase n=1 Tax=Sphingobium xe...   159    3e-36 
  UniRef100_W4HQ25 Sensor histidine kinase n=1 Tax=Roseivivax sp....   159    4e-36 
  UniRef100_UPI000375169F histidine kinase n=1 Tax=Sphingobium xe...   159    4e-36 
  UniRef100_Q131Y5 ATP-binding region, ATPase-like n=1 Tax=Rhodop...   159    4e-36 
  UniRef100_K8P2W6 Uncharacterized protein n=1 Tax=Afipia clevela...   158    4e-36 
  UniRef100_R0EFV6 Signal transduction histidine kinase n=1 Tax=R...   158    4e-36 
  UniRef100_I0GEU4 Putative two-component sensor histidine kinase...   158    4e-36 
  UniRef100_B1Y0Q3 Histidine kinase n=1 Tax=Leptothrix cholodnii ...   158    5e-36 
  UniRef100_J0JLP4 Uncharacterized protein n=1 Tax=Alcaligenes fa...   158    5e-36 
  UniRef100_D0D1V2 Sensor histidine kinase n=1 Tax=Citreicella sp...   158    5e-36 
  UniRef100_UPI000363069B hypothetical protein n=1 Tax=Thiobacill...   158    5e-36 
  UniRef100_H5YA95 Signal transduction histidine kinase n=1 Tax=B...   158    5e-36 
  UniRef100_UPI000371531D MULTISPECIES: hypothetical protein n=1 ...   158    5e-36 
  UniRef100_I2QHG6 Signal transduction histidine kinase n=1 Tax=B...   158    5e-36 
  UniRef100_Q2IYP2 Periplasmic sensor signal transduction histidi...   158    5e-36 
  UniRef100_K8NT88 Uncharacterized protein n=1 Tax=Afipia felis A...   158    5e-36 
  UniRef100_G2D979 Periplasmic sensor signal transduction histidi...   158    6e-36 
  UniRef100_UPI000369634F membrane protein n=1 Tax=Cupriavidus ta...   157    6e-36 
  UniRef100_K2HCY6 Uncharacterized protein n=1 Tax=Oceaniovalibus...   157    7e-36 
  UniRef100_J2VZI7 Signal transduction histidine kinase n=1 Tax=B...   157    7e-36 
  UniRef100_N1MUK7 Sensor histidine kinase n=1 Tax=Sphingobium ja...   157    7e-36 
  UniRef100_A9BVX6 Histidine kinase n=4 Tax=Delftia RepID=A9BVX6_...   157    8e-36 
  UniRef100_D6V7J6 Integral membrane sensor signal transduction h...   157    9e-36 
  UniRef100_UPI00037E7EF4 ATPase n=1 Tax=Mesorhizobium sp. WSM434...   157    1e-35 
  UniRef100_J2V6L3 Signal transduction histidine kinase n=1 Tax=H...   157    1e-35 
  UniRef100_G7D4M0 Two-component hybrid sensor and regulator n=1 ...   157    1e-35 
  UniRef100_B2JFV3 Integral membrane sensor signal transduction h...   157    1e-35 
  UniRef100_U3QDA6 Membrane protein n=1 Tax=Ralstonia pickettii D...   157    1e-35 
  UniRef100_A1WR08 Integral membrane sensor signal transduction h...   157    1e-35 
  UniRef100_W1JYI6 Two-component hybrid sensor and regulator n=1 ...   157    1e-35 
  UniRef100_H0TQS2 Putative two-component sensor histidine kinase...   157    1e-35 
  UniRef100_UPI000367B47F ATPase n=1 Tax=Bradyrhizobium japonicum...   157    1e-35 
  UniRef100_V6F6C8 Putative two-component sensor histidine kinase...   156    1e-35 
  UniRef100_K8PEU9 Uncharacterized protein n=1 Tax=Afipia broomea...   156    1e-35 
  UniRef100_UPI0003641528 hypothetical protein n=1 Tax=Uliginosib...   156    1e-35 
  UniRef100_W8S5D6 Sensor histidine kinase n=1 Tax=Roseibacterium...   156    1e-35 
  UniRef100_M5IV83 Uncharacterized protein n=2 Tax=Alcaligenes Re...   156    2e-35 
  UniRef100_UPI0003741245 hypothetical protein n=1 Tax=beta prote...   156    2e-35 
  UniRef100_A4U0Z7 Osmolarity sensor protein n=1 Tax=Magnetospiri...   156    2e-35 
  UniRef100_N0ADI3 HAMP domain protein n=1 Tax=Burkholderia thail...   156    2e-35 
  UniRef100_Q0BCX2 Periplasmic sensor signal transduction histidi...   156    2e-35 
  UniRef100_UPI00035E52D0 hypothetical protein n=1 Tax=Oligella u...   156    2e-35 
  UniRef100_D7A0W8 Integral membrane sensor signal transduction h...   156    2e-35 
  UniRef100_B3R0V3 Putative sensor histine kinase n=1 Tax=Cupriav...   156    2e-35 
  UniRef100_R0FCH1 Sensor signal transduction histidine kinase n=...   156    2e-35 
  UniRef100_UPI00037E82D4 ATPase n=1 Tax=Bradyrhizobium japonicum...   156    2e-35 
  UniRef100_G2DVJ4 Integral membrane sensor signal transduction h...   156    2e-35 
  UniRef100_A4G6C1 Sensor protein n=1 Tax=Herminiimonas arsenicox...   156    2e-35 
  UniRef100_UPI0003768909 hypothetical protein n=1 Tax=Burkholder...   156    2e-35 
  UniRef100_UPI00036B0516 hypothetical protein n=1 Tax=Thiomonas ...   155    3e-35 
  UniRef100_R0G9Z3 Oxidative stress resistance two component tran...   155    3e-35 
  UniRef100_I4MNY6 Sensor signal transduction histidine kinase n=...   155    3e-35 
  UniRef100_B8IM28 Histidine kinase n=1 Tax=Methylobacterium nodu...   155    3e-35 
  UniRef100_Q0FHV2 Sensor histidine kinase n=1 Tax=Pelagibaca ber...   155    3e-35 
  UniRef100_Q1YLY6 Sensor histidine kinase, ATP-binding region n=...   155    3e-35 
  UniRef100_UPI0003B486D1 histidine kinase n=1 Tax=Ponticaulis ko...   155    3e-35 
  UniRef100_J2M8Y9 Signal transduction histidine kinase n=1 Tax=H...   155    4e-35 
  UniRef100_UPI0002FA08B0 ATPase n=1 Tax=Bradyrhizobium elkanii R...   155    4e-35 
  UniRef100_A3WY28 Signal transduction histidine kinase n=1 Tax=N...   155    4e-35 
  UniRef100_H1SFG0 Sensor histidine kinase n=1 Tax=Cupriavidus ba...   155    4e-35 
  UniRef100_Q89DH7 Two-component hybrid sensor and regulator n=1 ...   155    4e-35 
  UniRef100_C9CXD6 Periplasmic sensor signal transduction histidi...   155    4e-35 
  UniRef100_I9WCH7 Periplasmic sensor signal transduction histidi...   155    4e-35 
  UniRef100_V4RA43 Histidine kinase n=1 Tax=Asticcacaulis sp. AC4...   155    5e-35 
  UniRef100_Q20XG1 Periplasmic sensor signal transduction histidi...   154    5e-35 
  UniRef100_F4QSH5 Histidine kinase-, DNA gyrase B-, and HSP90-li...   154    6e-35 
  UniRef100_S9TB42 Uncharacterized protein n=1 Tax=Ralstonia sp. ...   154    6e-35 
  UniRef100_Q11N99 Periplasmic sensor signal transduction histidi...   154    6e-35 
  UniRef100_A0A022FQK1 Membrane protein n=1 Tax=Cupriavidus sp. S...   154    6e-35 
  UniRef100_UPI00036E936B histidine kinase n=1 Tax=Methylobacteri...   154    6e-35 
  UniRef100_K0IBP7 Integral membrane sensor signal transduction h...   154    6e-35 
  UniRef100_B1FR61 Integral membrane sensor signal transduction h...   154    7e-35 
  UniRef100_Q1GGK4 Periplasmic sensor signal transduction histidi...   154    7e-35 
  UniRef100_B0UA57 Integral membrane sensor signal transduction h...   154    7e-35 
  UniRef100_Q07RQ7 Periplasmic sensor signal transduction histidi...   154    7e-35 
  UniRef100_B1YUP3 Integral membrane sensor signal transduction h...   154    7e-35 
  UniRef100_UPI0002377806 histidine kinase n=1 Tax=Acidovorax rad...   154    7e-35 
  UniRef100_S6B505 Sensor histidine kinase n=1 Tax=Sulfuricella d...   154    7e-35 
  UniRef100_UPI0002DD52F2 histidine kinase n=1 Tax=Phaeobacter ga...   154    7e-35 
  UniRef100_F2LR24 Periplasmic sensor signal transduction histidi...   154    8e-35 
  UniRef100_W3RNU4 ATPase n=1 Tax=Afipia sp. P52-10 RepID=W3RNU4_...   154    8e-35 
  UniRef100_G7Z4T2 Signal tranduction histidine kinase n=1 Tax=Az...   154    8e-35 
  UniRef100_F0IWZ7 Two-component sensor histidine kinase n=1 Tax=...   154    8e-35 
  UniRef100_A5FWU0 Signal transduction histidine kinase n=1 Tax=A...   154    8e-35 
  UniRef100_G0EWQ6 Osmolarity sensor protein EnvZ n=1 Tax=Cupriav...   154    9e-35 
  UniRef100_E8TRH2 ATP-binding region ATPase domain protein n=2 T...   154    9e-35 
  UniRef100_J0KMR7 Signal transduction histidine kinase n=1 Tax=A...   154    9e-35 
  UniRef100_B6QZL9 Signal transduction histidine kinase n=1 Tax=P...   154    1e-34 
  UniRef100_G8PGH2 Periplasmic sensor signal transduction histidi...   154    1e-34 
  UniRef100_B6JIR1 Putative osmolarity sensor protein EnvZ n=2 Ta...   154    1e-34 
  UniRef100_U1H0G4 Two-component system, OmpR family, osmolarity ...   154    1e-34 
  UniRef100_UPI00031604FE sensor histidine kinase n=1 Tax=Herbasp...   153    1e-34 
  UniRef100_Q0KE36 Signal transduction histidine kinase n=2 Tax=B...   153    1e-34 
  UniRef100_UPI000365F2C2 hypothetical protein n=1 Tax=Methylover...   153    1e-34 
  UniRef100_K9HED8 Histidine kinase n=1 Tax=Caenispirillum salina...   153    2e-34 
  UniRef100_UPI00035D3F1E membrane protein n=1 Tax=Cupriavidus sp...   153    2e-34 
  UniRef100_A0A016XCL2 Histidine kinase n=1 Tax=Hylemonella graci...   153    2e-34 
  UniRef100_UPI000376C6FD histidine kinase n=1 Tax=Loktanella ves...   153    2e-34 
  UniRef100_Q3SPM1 Signal transduction histidine kinase n=1 Tax=N...   153    2e-34 
  UniRef100_H0C1C5 Integral membrane sensor signal transduction h...   153    2e-34 
  UniRef100_V4NHT0 Histidine kinase n=1 Tax=Asticcacaulis sp. AC4...   152    2e-34 
  UniRef100_UPI00036CC297 hypothetical protein n=1 Tax=Burkholder...   152    2e-34 
  UniRef100_G2KSJ3 HAMP domain protein n=1 Tax=Micavibrio aerugin...   152    2e-34 
  UniRef100_UPI0002DCB288 hypothetical protein n=1 Tax=Herbaspiri...   152    2e-34 
  UniRef100_I3YFD2 Signal transduction histidine kinase n=1 Tax=T...   152    2e-34 
  UniRef100_A0A013VSD1 Histidine kinase n=1 Tax=Sphingobium sp. A...   152    3e-34 
  UniRef100_UPI00035C7772 membrane protein n=1 Tax=Cupriavidus sp...   152    3e-34 
  UniRef100_H8Z3E8 Signal transduction histidine kinase n=1 Tax=T...   152    3e-34 
  UniRef100_H0T0B9 Putative two-component sensor histidine kinase...   152    3e-34 
  UniRef100_D5RPD8 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   152    3e-34 
  UniRef100_M4VER6 Putative signal transduction histidine kinase ...   152    3e-34 
  UniRef100_UPI000174659F histidine kinase n=1 Tax=Verrucomicrobi...   152    3e-34 
  UniRef100_N0B9G0 Integral membrane sensor signal transduction h...   152    3e-34 
  UniRef100_W6K9G0 Putative histidine kinase n=1 Tax=Magnetospiri...   152    3e-34 
  UniRef100_I3CUP5 Oxidative stress resistance two component tran...   152    3e-34 
  UniRef100_B9MD05 Histidine kinase n=1 Tax=Acidovorax ebreus (st...   152    4e-34 
  UniRef100_UPI000379A055 ATPase n=1 Tax=Pannonibacter phragmitet...   152    4e-34 
  UniRef100_W0V4Z5 Putative oxidative stress related two componen...   152    4e-34 
  UniRef100_C5T6E3 Histidine kinase n=1 Tax=Acidovorax delafieldi...   152    4e-34 
  UniRef100_A6SXV5 Two-component sensor kinase EnvZ n=1 Tax=Janth...   152    4e-34 
  UniRef100_V6J356 HAMP domain protein n=1 Tax=Pseudomonas putida...   152    4e-34 
  UniRef100_Q2ISE6 Periplasmic sensor signal transduction histidi...   151    5e-34 
  UniRef100_F8JBR8 Putative two-component sensor histidine kinase...   151    5e-34 
  UniRef100_A1WAK4 Integral membrane sensor signal transduction h...   151    5e-34 
  UniRef100_K2EHU8 Uncharacterized protein n=1 Tax=uncultured bac...   151    5e-34 
  UniRef100_F6IMJ4 Periplasmic sensor signal transduction histidi...   151    5e-34 
  UniRef100_E3F2D9 Integral membrane sensor signal transduction h...   151    6e-34 
  UniRef100_UPI00037C7F05 hypothetical protein n=1 Tax=Oligella u...   151    6e-34 
  UniRef100_V4J5D9 Uncharacterized protein n=1 Tax=uncultured Thi...   151    6e-34 
  UniRef100_B7QTU9 Periplasmic sensor signal transduction histidi...   151    6e-34 
  UniRef100_G6E952 Periplasmic sensor signal transduction histidi...   151    7e-34 
  UniRef100_K2NL98 Periplasmic sensor signal transduction histidi...   151    7e-34 
  UniRef100_V5SFP2 ATPase n=1 Tax=Hyphomicrobium nitrativorans NL...   150    8e-34 
  UniRef100_K9HEI0 Osmolarity sensor protein EnvZ n=1 Tax=Caenisp...   150    8e-34 
  UniRef100_UPI000369F0D9 hypothetical protein n=1 Tax=Leeia oryz...   150    8e-34 
  UniRef100_A0A022GWI9 Histidine kinase n=1 Tax=Cupriavidus sp. S...   150    8e-34 
  UniRef100_D8IT93 Oxidative stress resistance two component tran...   150    9e-34 
  UniRef100_UPI0002375E06 histidine kinase n=1 Tax=Verminephrobac...   150    9e-34 
  UniRef100_E2CKC8 Integral membrane sensor signal transduction h...   150    9e-34 
  UniRef100_F8JF09 Putative integral membrane sensor signal trans...   150    1e-33 
  UniRef100_G5ZZD8 Signal transduction histidine kinase n=1 Tax=S...   150    1e-33 
  UniRef100_E2SSW3 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   150    1e-33 
  UniRef100_UPI0002F2CB9D membrane protein n=1 Tax=Cupriavidus sp...   150    1e-33 
  UniRef100_UPI000365C699 histidine kinase n=1 Tax=Burkholderia b...   150    1e-33 
  UniRef100_H0RW37 Putative two-component sensor histidine kinase...   150    1e-33 
  UniRef100_M1GP98 Integral membrane sensor signal transduction h...   150    1e-33 
  UniRef100_I3YEX3 Peroxiredoxin n=1 Tax=Thiocystis violascens (s...   150    1e-33 
  UniRef100_A0A022GF33 Membrane protein n=1 Tax=Cupriavidus sp. S...   150    1e-33 
  UniRef100_UPI00035D80A3 sensor histidine kinase n=1 Tax=Herbasp...   150    1e-33 
  UniRef100_A7HVE9 Integral membrane sensor signal transduction h...   150    1e-33 
  UniRef100_UPI0003B5A5AB ATPase n=1 Tax=Fodinicurvata sediminis ...   150    1e-33 
  UniRef100_D7A6C1 Integral membrane sensor signal transduction h...   150    1e-33 
  UniRef100_A3XX82 Signal transduction histidine kinase n=1 Tax=V...   150    1e-33 
  UniRef100_F1VZN9 Signal transduction histidine kinase n=1 Tax=O...   150    2e-33 
  UniRef100_E0TFL2 Sensor histidine kinase n=1 Tax=Parvularcula b...   150    2e-33 
  UniRef100_A2VXK2 Signal transduction histidine kinase n=1 Tax=B...   150    2e-33 
  UniRef100_W6LQW6 Putative two-component sensor histidine kinase...   149    2e-33 
  UniRef100_S9S6H5 Membrane protein n=1 Tax=Ralstonia sp. AU12-08...   149    2e-33 
  UniRef100_UPI000225F708 histidine kinase n=1 Tax=Paracoccus sp....   149    2e-33 
  UniRef100_A4EQQ7 Sensor histidine kinase n=1 Tax=Roseobacter sp...   149    2e-33 
  UniRef100_K2LS19 Sensor histidine kinase n=1 Tax=Thalassospira ...   149    2e-33 
  UniRef100_J9Z132 Histidine kinase with HAMP domain protein n=1 ...   149    2e-33 
  UniRef100_A3XBC9 Sensor histidine kinase n=1 Tax=Roseobacter sp...   149    2e-33 
  UniRef100_UPI0003B67FEC histidine kinase n=1 Tax=Thalassospira ...   149    2e-33 
  UniRef100_W0PCB0 Putative signal transduction histidine kinase ...   149    2e-33 
  UniRef100_J0QLU3 Uncharacterized protein n=1 Tax=Bartonella rat...   149    2e-33 
  UniRef100_H0A5U7 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   149    2e-33 
  UniRef100_M4S112 Integral membrane sensor signal transduction h...   149    2e-33 
  UniRef100_K2QFY6 Two-component sensor histidine kinase n=1 Tax=...   149    2e-33 
  UniRef100_G0AGL2 Osmolarity sensory histidine kinase n=1 Tax=Co...   149    2e-33 
  UniRef100_UPI00035C8C17 hypothetical protein n=1 Tax=Thiobacill...   149    2e-33 
  UniRef100_M4ZEM4 Two-component sensor histidine kinase n=1 Tax=...   149    3e-33 
  UniRef100_I6XUU7 Histidine kinase n=1 Tax=Zymomonas mobilis sub...   149    3e-33 
  UniRef100_F2LFS3 Osmolarity sensor protein EnvZ, putative n=1 T...   149    3e-33 
  UniRef100_Q167K5 Sensor histidine kinase, putative n=1 Tax=Rose...   149    3e-33 
  UniRef100_A4Z0L9 Putative two-component sensor histidine kinase...   149    3e-33 
  UniRef100_B5WVY4 Histidine kinase (Fragment) n=1 Tax=Burkholder...   149    3e-33 
  UniRef100_UPI000288F09A periplasmic sensor signal transduction ...   149    3e-33 
  UniRef100_G8ARE9 Signal tranduction histidine kinase n=1 Tax=Az...   149    3e-33 
  UniRef100_F0E8E1 Integral membrane sensor signal transduction h...   149    3e-33 
  UniRef100_UPI000381E139 hypothetical protein n=1 Tax=Martelella...   149    3e-33 
  UniRef100_A8LNY1 Histidine kinase n=1 Tax=Dinoroseobacter shiba...   149    3e-33 
  UniRef100_K4HHI6 Sensor histidine kinase n=1 Tax=Bartonella qui...   149    3e-33 
  UniRef100_C6ACF3 Sensor histidine kinase EnvZ n=1 Tax=Bartonell...   149    3e-33 
  UniRef100_I7EW59 Sensor histidine kinase n=1 Tax=Phaeobacter in...   149    3e-33 
  UniRef100_D3NUC2 Two-component sensor histidine kinase n=1 Tax=...   149    3e-33 
  UniRef100_B7VL56 Signal transduction histidine kinase n=1 Tax=V...   149    4e-33 
  UniRef100_W3TTV5 Uncharacterized protein n=2 Tax=Bartonella qui...   149    4e-33 
  UniRef100_C8WFM1 Histidine kinase n=1 Tax=Zymomonas mobilis sub...   148    4e-33 
  UniRef100_Q6G0F0 Sensor histidine kinase n=4 Tax=Bartonella qui...   148    4e-33 
  UniRef100_F3WT61 HAMP domain protein n=1 Tax=Sphingomonas sp. S...   148    4e-33 
  UniRef100_UPI0003B6844E histidine kinase n=1 Tax=Rhodopseudomon...   148    4e-33 
  UniRef100_J3HX25 Signal transduction histidine kinase n=1 Tax=H...   148    4e-33 
  UniRef100_B9BQU7 Periplasmic sensor signal transduction histidi...   148    5e-33 
  UniRef100_M9RNT7 Histidine kinase n=1 Tax=Octadecabacter arctic...   148    5e-33 
  UniRef100_W0VCZ4 HAMP domain protein n=1 Tax=Janthinobacterium ...   148    5e-33 
  UniRef100_F8DUD9 Integral membrane sensor signal transduction h...   148    5e-33 
  UniRef100_UPI00030C9F24 sensor histidine kinase n=1 Tax=Vibrio ...   148    5e-33 
  UniRef100_UPI000311C8E9 sensor histidine kinase n=1 Tax=Vibrio ...   148    5e-33 
  UniRef100_UPI000372B5ED hypothetical protein n=1 Tax=Sphingomon...   148    6e-33 
  UniRef100_R5Q069 Signal tranduction histidine kinase n=1 Tax=Ac...   148    6e-33 
  UniRef100_UPI0003776AC2 hypothetical protein n=1 Tax=Massilia n...   148    6e-33 
  UniRef100_J7J959 Integral membrane sensor signal transduction h...   148    6e-33 
  UniRef100_A5EPM7 Putative two component sensor histidine kinase...   148    6e-33 
  UniRef100_V9VSR1 Histidine kinase n=1 Tax=Leisingera methylohal...   148    6e-33 
  UniRef100_W1S714 Histidine kinase n=1 Tax=Sphingobium sp. C100 ...   148    6e-33 
  UniRef100_B1LZY4 Integral membrane sensor signal transduction h...   148    6e-33 
  UniRef100_UPI0002E8E0CF histidine kinase n=1 Tax=Herbaspirillum...   147    7e-33 
  UniRef100_A1K1G6 Probable sensor histidine kinase n=1 Tax=Azoar...   147    7e-33 
  UniRef100_W7DUH5 Osmolarity sensor protein envZ n=1 Tax=Commens...   147    7e-33 
  UniRef100_V5Q2J8 Osmolarity sensor protein EnvZ n=2 Tax=Zymomon...   147    7e-33 
  UniRef100_UPI00037DEC1F hypothetical protein n=1 Tax=Rhodocycla...   147    7e-33 
  UniRef100_A2W8B8 Sensor histidine kinase n=1 Tax=Burkholderia d...   147    7e-33 
  UniRef100_I7EL96 Sensor histidine kinase n=1 Tax=Phaeobacter ga...   147    7e-33 
  UniRef100_V8AE62 Histidine kinase n=3 Tax=Rhodobacter capsulatu...   147    7e-33 
  UniRef100_C3XAD2 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   147    7e-33 
  UniRef100_A8LSN3 Integral membrane sensor signal transduction h...   147    8e-33 
  UniRef100_Q07HK9 Periplasmic sensor signal transduction histidi...   147    8e-33 
  UniRef100_H8FSY1 Putative two-component sensor histidine kinase...   147    8e-33 
  UniRef100_V8H1E7 Histidine kinase n=2 Tax=Rhodobacter capsulatu...   147    8e-33 
  UniRef100_Q12A12 Periplasmic sensor signal transduction histidi...   147    8e-33 
  UniRef100_V8HD31 Histidine kinase n=1 Tax=Rhodobacter capsulatu...   147    9e-33 
  UniRef100_J0QLZ6 Uncharacterized protein n=2 Tax=Bartonella eli...   147    9e-33 
  UniRef100_F3KXE6 Integral membrane sensor signal transduction h...   147    1e-32 
  UniRef100_B9B4Q3 Periplasmic sensor signal transduction histidi...   147    1e-32 
  UniRef100_UPI00037125CB hypothetical protein n=1 Tax=Aureimonas...   147    1e-32 
  UniRef100_I9CR44 Integral membrane sensor signal transduction h...   147    1e-32 
  UniRef100_Q9X3V9 Chemotaxis protein n=1 Tax=Zymomonas mobilis R...   147    1e-32 
  UniRef100_E1V4P2 Integral membrane sensor signal transduction h...   147    1e-32 
  UniRef100_V2JK61 Membrane protein n=1 Tax=Cupriavidus sp. HPC(L...   147    1e-32 
  UniRef100_W9H4I6 ATPase n=1 Tax=Skermanella stibiiresistens SB2...   147    1e-32 
  UniRef100_F3KU11 Periplasmic sensor signal transduction histidi...   147    1e-32 
  UniRef100_UPI00035D0877 histidine kinase n=1 Tax=Bradyrhizobium...   147    1e-32 
  UniRef100_UPI00036E1CE2 histidine kinase n=1 Tax=Paracoccus sp....   147    1e-32 
  UniRef100_B9JIS7 Two-component sensor histidine kinase protein ...   147    1e-32 
  UniRef100_B2UI84 Integral membrane sensor signal transduction h...   147    1e-32 
  UniRef100_UPI000371A35D hypothetical protein n=1 Tax=Variovorax...   147    1e-32 
  UniRef100_D5AN21 Sensor histidine kinase n=1 Tax=Rhodobacter ca...   147    1e-32 
  UniRef100_UPI00036504A6 ATPase n=1 Tax=Methylobacterium sp. 285...   147    1e-32 
  UniRef100_Q39HX2 Periplasmic sensor signal transduction histidi...   147    1e-32 
  UniRef100_UPI000360067A hypothetical protein n=1 Tax=Bradyrhizo...   147    1e-32 
  UniRef100_A9IRA8 Sensor histidine kinase n=2 Tax=Bartonella tri...   147    1e-32 
  UniRef100_UPI00036BAA01 hypothetical protein n=1 Tax=Chitiniphi...   147    1e-32 
  UniRef100_J2D3D8 Signal transduction histidine kinase n=1 Tax=R...   146    1e-32 
  UniRef100_U5VKY0 Integral membrane sensor signal transduction h...   146    2e-32 
  UniRef100_R0EAV6 Signal transduction histidine kinase n=1 Tax=R...   146    2e-32 
  UniRef100_B4E7U4 Two-component regulatory system, sensor kinase...   146    2e-32 
  UniRef100_G7HKX8 Osmolarity sensory histidine kinase EnvZ n=1 T...   146    2e-32 
  UniRef100_E3I6F3 Integral membrane sensor signal transduction h...   146    2e-32 
  UniRef100_T0EJ68 GHKL domain protein n=1 Tax=Burkholderia cenoc...   146    2e-32 
  UniRef100_UPI0003672703 MULTISPECIES: ATPase n=1 Tax=Xanthobact...   146    2e-32 
  UniRef100_UPI0002DDEAC7 hypothetical protein n=1 Tax=Roseomonas...   146    2e-32 
  UniRef100_W4NHB8 Osmolarity sensory histidine kinase EnvZ n=1 T...   146    2e-32 
  UniRef100_UPI00035CBE08 hypothetical protein n=1 Tax=Woodsholea...   146    2e-32 
  UniRef100_U1IBU6 PhnG protein n=1 Tax=Bradyrhizobium sp. DFCI-1...   146    2e-32 
  UniRef100_J6UHW4 Putative two-component sensor n=1 Tax=Rhodovul...   146    2e-32 
  UniRef100_A2VWD0 ATP-binding region, ATPase-like n=1 Tax=Burkho...   146    2e-32 
  UniRef100_UPI0003669BE5 hypothetical protein n=1 Tax=Elioraea t...   146    2e-32 
  UniRef100_A6FRB3 Sensor histidine kinase, putative n=1 Tax=Rose...   146    2e-32 
  UniRef100_X6GFE4 ATPase n=1 Tax=Mesorhizobium sp. L48C026A00 Re...   146    2e-32 
  UniRef100_U3HAV1 Uncharacterized protein n=1 Tax=Pseudomonas al...   146    2e-32 
  UniRef100_UPI00034CB6A7 hypothetical protein n=1 Tax=Pandoraea ...   146    2e-32 
  UniRef100_UPI00037344F6 sensor histidine kinase n=1 Tax=Duganel...   146    2e-32 
  UniRef100_J2VG41 Signal transduction histidine kinase n=1 Tax=P...   146    2e-32 
  UniRef100_E4RC10 Integral membrane sensor signal transduction h...   146    2e-32 
  UniRef100_F7ZAP7 Histidine kinase n=1 Tax=Roseobacter litoralis...   146    2e-32 
  UniRef100_A3SPZ8 Sensor histidine kinase n=1 Tax=Roseovarius nu...   146    2e-32 
  UniRef100_I9X005 Integral membrane sensor signal transduction h...   145    2e-32 
  UniRef100_J3CY40 Signal transduction histidine kinase n=1 Tax=P...   145    3e-32 
  UniRef100_A9AIE9 Integral membrane sensor signal transduction h...   145    3e-32 
  UniRef100_UPI0002EE72D9 sensor histidine kinase n=1 Tax=Vibrio ...   145    3e-32 
  UniRef100_A5ECQ1 Signal transduction histidine kinase n=1 Tax=B...   145    3e-32 
  UniRef100_UPI0003715D2C hypothetical protein n=1 Tax=Lamprocyst...   145    3e-32 
  UniRef100_A0K9H3 Periplasmic sensor signal transduction histidi...   145    3e-32 
  UniRef100_U0ZLT6 Uncharacterized protein n=1 Tax=Pseudogulbenki...   145    3e-32 
  UniRef100_J0R7H1 Uncharacterized protein n=1 Tax=Bartonella tay...   145    3e-32 
  UniRef100_F4QGG9 RisS protein n=1 Tax=Asticcacaulis biprosthecu...   145    3e-32 
  UniRef100_W0AGU1 Uncharacterized protein n=1 Tax=Sphingomonas s...   145    3e-32 
  UniRef100_A9HAD2 Integral membrane sensor signal transduction h...   145    3e-32 
  UniRef100_UPI0003745299 histidine kinase n=1 Tax=Acidovorax sp....   145    3e-32 
  UniRef100_UPI00026CB94D histidine kinase n=1 Tax=Sphingomonas e...   145    3e-32 
  UniRef100_B1JWC8 Histidine kinase n=1 Tax=Burkholderia cenocepa...   145    3e-32 
  UniRef100_UPI0003B44DB2 histidine kinase n=1 Tax=Oceanicaulis a...   145    3e-32 
  UniRef100_A7IHA7 Integral membrane sensor signal transduction h...   145    3e-32 
  UniRef100_UPI00037ABC7B sensor histidine kinase n=1 Tax=Pseudom...   145    3e-32 
  UniRef100_UPI0003675888 hypothetical protein n=1 Tax=Martelella...   145    3e-32 
  UniRef100_F7ZMH8 Histidine kinase n=1 Tax=Roseobacter litoralis...   145    3e-32 
  UniRef100_C5CKQ3 Histidine kinase n=2 Tax=Variovorax paradoxus ...   145    3e-32 
  UniRef100_X5VN57 ATPase n=1 Tax=Mesorhizobium sp. LSHC422A00 Re...   145    3e-32 
  UniRef100_Q39DZ5 Periplasmic sensor signal transduction histidi...   145    4e-32 
  UniRef100_A9DH54 Probable two-component sensor histidine kinase...   145    4e-32 
  UniRef100_A1VQC2 Integral membrane sensor signal transduction h...   145    4e-32 
  UniRef100_A3SYE9 Sensor histidine kinase n=1 Tax=Sulfitobacter ...   145    4e-32 
  UniRef100_X5SC08 ATPase n=6 Tax=Mesorhizobium RepID=X5SC08_9RHIZ     145    4e-32 
  UniRef100_UPI0003826BAA ATPase n=1 Tax=Hoeflea sp. 108 RepID=UP...   145    4e-32 
  UniRef100_V4P5K0 Uncharacterized protein n=1 Tax=Asticcacaulis ...   145    4e-32 
  UniRef100_UPI0002E663DC sensor histidine kinase n=1 Tax=Vibrio ...   145    4e-32 
  UniRef100_V8QRN3 Histidine kinase n=1 Tax=Advenella kashmirensi...   145    4e-32 
  UniRef100_B6B1D6 Sensor histidine kinase n=1 Tax=Rhodobacterace...   145    4e-32 
  UniRef100_B6BSA5 Osmolarity sensor protein EnvZ n=1 Tax=Candida...   145    4e-32 
  UniRef100_UPI00036B62F1 hypothetical protein n=1 Tax=alpha prot...   145    4e-32 
  UniRef100_D8JSK1 Integral membrane sensor signal transduction h...   145    4e-32 
  UniRef100_A0LA53 Periplasmic sensor signal transduction histidi...   145    4e-32 
  UniRef100_UPI00034DFCD4 glycosyltransferase n=1 Tax=Ideonella s...   145    4e-32 
  UniRef100_W3YHZ6 Sensor protein CpxA n=2 Tax=Providencia alcali...   145    4e-32 
  UniRef100_A8IL12 Periplasmic sensor signal transduction histidi...   145    4e-32 
  UniRef100_U2FQV8 Osmolarity sensory histidine kinase EnvZ n=1 T...   145    4e-32 
  UniRef100_UPI0002FFCBAA hypothetical protein n=1 Tax=Vibrio cyc...   145    4e-32 
  UniRef100_N6UCM5 Putative two-component sensor histidine kinase...   145    4e-32 
  UniRef100_M2YAX6 Signal transduction histidine kinase n=1 Tax=M...   145    5e-32 
  UniRef100_A3UT62 Signal transduction histidine kinase n=1 Tax=V...   145    5e-32 
  UniRef100_Q6LG25 Putative Signal transduction histidine kinase ...   145    5e-32 
  UniRef100_J2SYF3 Signal transduction histidine kinase n=1 Tax=V...   145    5e-32 
  UniRef100_G4QC79 Putative two-component sensor n=1 Tax=Taylorel...   145    5e-32 
  UniRef100_A4YZP7 Putative two component sensor histidine kinase...   145    5e-32 
  UniRef100_UPI0003C7F093 ATPase n=1 Tax=Pelagibacter ubique RepI...   145    5e-32 
  UniRef100_U7GMV3 ATPase n=2 Tax=Labrenzia RepID=U7GMV3_9RHOB         145    5e-32 
  UniRef100_D8IPY6 Two component sensor histidine kinase protein ...   145    5e-32 
  UniRef100_E2CNC1 Integral membrane sensor signal transduction h...   145    5e-32 
  UniRef100_W9VCM8 Signal transduction histidine kinase n=1 Tax=T...   145    5e-32 
  UniRef100_R5QWW5 Signal transduction histidine kinase n=1 Tax=P...   144    5e-32 
  UniRef100_D8DCL8 Periplasmic sensor signal transduction n=1 Tax...   144    5e-32 
  UniRef100_B0KI23 Integral membrane sensor signal transduction h...   144    6e-32 
  UniRef100_X5QYI4 ATPase n=1 Tax=Mesorhizobium sp. LSJC269B00 Re...   144    6e-32 
  UniRef100_U1KLS3 Sensor signal transduction histidine kinase n=...   144    6e-32 
  UniRef100_A9E5D8 Sensor histidine kinase, putative n=1 Tax=Ocea...   144    6e-32 
  UniRef100_UPI00023766AC histidine kinase n=1 Tax=Acidovorax rad...   144    6e-32 
  UniRef100_K9DYJ2 Uncharacterized protein n=1 Tax=Massilia timon...   144    6e-32 
  UniRef100_E6UV14 Integral membrane sensor signal transduction h...   144    6e-32 
  UniRef100_H0SY50 Putative two component sensor histidine kinase...   144    6e-32 
  UniRef100_I3XBE7 Osmolarity sensor protein EnvZ n=1 Tax=Sinorhi...   144    6e-32 
  UniRef100_W8I3T9 Putative two-component sensor histidine kinase...   144    6e-32 
  UniRef100_V9WI47 Signal transduction histidine kinase n=1 Tax=P...   144    6e-32 
  UniRef100_U5UUN8 HAMP domain protein n=1 Tax=Burkholderia pseud...   144    6e-32 
  UniRef100_V7EZ19 ATPase n=26 Tax=Mesorhizobium RepID=V7EZ19_9RHIZ    144    6e-32 
  UniRef100_UPI0002F1FA13 sensor histidine kinase n=1 Tax=Vibrio ...   144    7e-32 
  UniRef100_UPI000379711E hypothetical protein n=1 Tax=alpha prot...   144    7e-32 
  UniRef100_B7WXL7 Histidine kinase n=2 Tax=Comamonas testosteron...   144    7e-32 
  UniRef100_V5UD28 Membrane protein n=1 Tax=Pandoraea sp. RB-44 R...   144    7e-32 
  UniRef100_H1RV88 Periplasmic sensor signal transduction n=1 Tax...   144    7e-32 
  UniRef100_X6I8A6 ATPase n=2 Tax=Mesorhizobium RepID=X6I8A6_9RHIZ     144    7e-32 
  UniRef100_UPI00030E0262 sensor histidine kinase n=1 Tax=Vibrio ...   144    7e-32 
  UniRef100_D0J711 Periplasmic sensor signal transduction n=1 Tax...   144    7e-32 
  UniRef100_Q62LA2 Osmolarity sensor protein EnvZ, putative n=10 ...   144    7e-32 
  UniRef100_U0EXW6 Uncharacterized protein n=1 Tax=Vibrio coralli...   144    7e-32 
  UniRef100_J3DB41 Signal transduction histidine kinase n=1 Tax=H...   144    7e-32 
  UniRef100_C8S0H1 Histidine kinase n=1 Tax=Rhodobacter sp. SW2 R...   144    7e-32 
  UniRef100_F0J2K9 Putative two-component sensor histidine kinase...   144    7e-32 
  UniRef100_S9SAX6 Signal transduction histidine kinase n=1 Tax=P...   144    7e-32 
  UniRef100_Q1ZBC0 Putative Signal transduction histidine kinase ...   144    8e-32 
  UniRef100_D0RRP3 Signal transduction histidine kinase n=1 Tax=a...   144    8e-32 
  UniRef100_J0RPA7 Uncharacterized protein n=1 Tax=Bartonella vin...   144    8e-32 
  UniRef100_UPI00037AC1B5 hypothetical protein n=1 Tax=alpha prot...   144    8e-32 
  UniRef100_UPI0002FE087F sensor histidine kinase n=1 Tax=Vibrio ...   144    8e-32 
  UniRef100_R5XPN3 Osmolarity sensor protein n=1 Tax=Acetobacter ...   144    8e-32 
  UniRef100_B2JEL9 Integral membrane sensor signal transduction h...   144    8e-32 
  UniRef100_K8NIT1 Uncharacterized protein n=1 Tax=Afipia felis A...   144    8e-32 
  UniRef100_UPI00031D3E31 sensor histidine kinase n=1 Tax=Vibrio ...   144    8e-32 
  UniRef100_UPI0003B7B609 histidine kinase n=1 Tax=Pseudorhodobac...   144    8e-32 
  UniRef100_UPI0002E95BBC hypothetical protein n=1 Tax=Limnohabit...   144    9e-32 
  UniRef100_K9E023 Uncharacterized protein n=1 Tax=Massilia timon...   144    9e-32 
  UniRef100_UPI00037B4E65 histidine kinase n=1 Tax=Variovorax par...   144    9e-32 
  UniRef100_T0HJW3 Histidine kinase n=1 Tax=Sphingobium lactosute...   144    9e-32 
  UniRef100_J0QRB9 Uncharacterized protein n=1 Tax=Bartonella vin...   144    9e-32 
  UniRef100_C4KT64 Signal transduction histidine kinase n=11 Tax=...   144    9e-32 
  UniRef100_F8FY90 Integral membrane sensor signal transduction h...   144    9e-32 
  UniRef100_UPI0002F53251 sensor histidine kinase n=1 Tax=Vibrio ...   144    9e-32 
  UniRef100_I7JM44 Sensor kinase n=1 Tax=Taylorella asinigenitali...   144    9e-32 
  UniRef100_T1XC55 Two component transcriptional regulator, senso...   144    1e-31 
  UniRef100_C3MFI9 Putative two-component sensor histidine kinase...   144    1e-31 
  UniRef100_UPI00037D4E84 hypothetical protein n=1 Tax=alpha prot...   144    1e-31 
  UniRef100_UPI00036E4818 hypothetical protein n=1 Tax=Hahella ga...   144    1e-31 
  UniRef100_V8UJF7 GHKL domain protein n=2 Tax=Bordetella pertuss...   144    1e-31 
  UniRef100_A8KTE3 Sensor histidine kinase n=1 Tax=Burkholderia p...   144    1e-31 
  UniRef100_B9T8X1 Sensory transduction histidine kinase, putativ...   144    1e-31 
  UniRef100_UPI00036E55A6 hypothetical protein n=1 Tax=Paracoccus...   144    1e-31 
  UniRef100_S5XY86 Two-component system, OmpR family, osmolarity ...   144    1e-31 
  UniRef100_UPI0003A11061 histidine kinase n=1 Tax=Sphingobium sp...   144    1e-31 
  UniRef100_M5FEX0 Sensor protein n=1 Tax=Mesorhizobium sp. STM 4...   144    1e-31 
  UniRef100_J1JNE2 Uncharacterized protein n=1 Tax=Bartonella was...   144    1e-31 
  UniRef100_J0Q7R5 Uncharacterized protein n=1 Tax=Bartonella was...   144    1e-31 
  UniRef100_V5PN93 Membrane protein n=2 Tax=Pandoraea pnomenusa R...   143    1e-31 
  UniRef100_D5BP12 Periplasmic Sensor Signal Transduction Histidi...   143    1e-31 
  UniRef100_I1WLF7 Signal transduction histidine kinase n=12 Tax=...   143    1e-31 
  UniRef100_V7GR57 ATPase n=1 Tax=Mesorhizobium sp. LNJC380A00 Re...   143    1e-31 
  UniRef100_D1P7K4 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   143    1e-31 
  UniRef100_A4JGT4 Integral membrane sensor signal transduction h...   143    1e-31 
  UniRef100_UPI0002EDB398 sensor histidine kinase n=1 Tax=Vibrio ...   143    1e-31 
  UniRef100_UPI0002EED097 sensor histidine kinase n=1 Tax=Vibrio ...   143    1e-31 
  UniRef100_Q2W1X5 Signal transduction histidine kinase n=1 Tax=M...   143    1e-31 
  UniRef100_A4WSH2 Integral membrane sensor signal transduction h...   143    1e-31 
  UniRef100_UPI00028A17DD histidine kinase n=1 Tax=Halomonas sp. ...   143    1e-31 
  UniRef100_H0HUQ4 Integral membrane sensor signal transduction h...   143    1e-31 
  UniRef100_J2VWD7 Signal transduction histidine kinase n=1 Tax=B...   143    1e-31 
  UniRef100_UPI0003B63108 ATPase n=1 Tax=Rhizobium mongolense Rep...   143    2e-31 
  UniRef100_A8TR63 Signal transduction histidine kinase n=1 Tax=a...   143    2e-31 
  UniRef100_I3CSY5 Two component sensor histidine kinase n=1 Tax=...   143    2e-31 
  UniRef100_B6XJR9 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   143    2e-31 
  UniRef100_H0SY29 Putative two component sensor histidine kinase...   143    2e-31 
  UniRef100_A3N724 Sensor histidine kinase n=6 Tax=Burkholderia p...   143    2e-31 
  UniRef100_H1S1K7 Periplasmic sensor signal transduction histidi...   143    2e-31 
  UniRef100_I6APX2 Signal transduction histidine kinase n=1 Tax=O...   143    2e-31 
  UniRef100_Q1QUU4 Signal transduction histidine kinase n=1 Tax=C...   143    2e-31 
  UniRef100_V7ENN7 Histidine kinase n=1 Tax=Rhodobacter sp. CACIA...   143    2e-31 
  UniRef100_J8VD93 Integral membrane sensor signal transduction h...   143    2e-31 
  UniRef100_G8MIK6 Integral membrane sensor signal transduction h...   143    2e-31 
  UniRef100_UPI0003739943 hypothetical protein n=1 Tax=Novispiril...   143    2e-31 
  UniRef100_F0Q973 Integral membrane sensor signal transduction h...   143    2e-31 
  UniRef100_UPI00030D0A72 sensor histidine kinase n=1 Tax=Vibrio ...   143    2e-31 
  UniRef100_V8A675 Histidine kinase n=1 Tax=Asaia sp. SF2.1 RepID...   143    2e-31 
  UniRef100_V9WRQ3 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   143    2e-31 
  UniRef100_UPI000377BBC3 hypothetical protein, partial n=1 Tax=P...   143    2e-31 
  UniRef100_L1QQD9 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   143    2e-31 
  UniRef100_V4IU26 Sensor histidine kinase n=1 Tax=Pseudomonas pu...   143    2e-31 
  UniRef100_A5GSK2 Two-component system sensor histidine kinase n...   143    2e-31 
  UniRef100_UPI0002E11F16 hypothetical protein n=1 Tax=Chelatococ...   142    2e-31 
  UniRef100_UPI000288DE21 sensor histidine kinase n=1 Tax=Janthin...   142    2e-31 
  UniRef100_UPI0003629953 hypothetical protein n=1 Tax=Brachymona...   142    2e-31 
  UniRef100_W6K6S3 Osmolarity sensory histidine kinase n=1 Tax=Ma...   142    2e-31 
  UniRef100_F4QUG4 Histidine kinase-, DNA gyrase B-, and HSP90-li...   142    2e-31 
  UniRef100_W6WI87 Integral membrane sensor signal transduction h...   142    2e-31 
  UniRef100_B8ILN7 Histidine kinase n=1 Tax=Methylobacterium nodu...   142    2e-31 
  UniRef100_A6E5Q7 Sensor histidine kinase n=1 Tax=Roseovarius sp...   142    2e-31 
  UniRef100_I6AMB1 Two-component system, sensor kinase n=2 Tax=Bu...   142    2e-31 
  UniRef100_L0FEA1 Integral membrane sensor signal transduction h...   142    2e-31 
  UniRef100_UPI00026304D1 histidine kinase n=1 Tax=Xanthomonas sa...   142    2e-31 
  UniRef100_B9KJV5 Sensor protein n=1 Tax=Rhodobacter sphaeroides...   142    2e-31 
  UniRef100_A4SST0 Two-component system sensor histidine kinase n...   142    3e-31 
  UniRef100_D7A3J4 Integral membrane sensor signal transduction h...   142    3e-31 
  UniRef100_UPI000371AA71 ATPase n=1 Tax=Ensifer sp. Br816 RepID=...   142    3e-31 
  UniRef100_V6EWC8 Putative signal transduction histidine kinase ...   142    3e-31 
  UniRef100_K2JGC6 Histidine kinase n=1 Tax=Oceanibaculum indicum...   142    3e-31 
  UniRef100_W9W3S3 Periplasmic Sensor Signal Transduction Histidi...   142    3e-31 
  UniRef100_U6ZXZ4 Histidine kinase n=1 Tax=Pseudomonas sp. CMAA1...   142    3e-31 
  UniRef100_UPI00035E45AE hypothetical protein n=1 Tax=Methylobac...   142    3e-31 
  UniRef100_A3PKS7 Integral membrane sensor signal transduction h...   142    3e-31 
  UniRef100_UPI0003A92F82 histidine kinase n=1 Tax=Maricaulis sp....   142    3e-31 
  UniRef100_UPI0002D36D52 sensor histidine kinase n=1 Tax=Vibrio ...   142    3e-31 
  UniRef100_UPI00035C340A hypothetical protein n=1 Tax=Ahrensia k...   142    3e-31 
  UniRef100_F3KWW9 Sensor histidine kinase n=1 Tax=Hylemonella gr...   142    3e-31 
  UniRef100_A0A023EAV0 Putative two-component histidine kinase n=...   142    3e-31 
  UniRef100_C4L774 Histidine kinase n=1 Tax=Tolumonas auensis (st...   142    3e-31 
  UniRef100_A5EPP6 Putative two component sensor histidine kinase...   142    3e-31 
  UniRef100_R0G7M9 Two component sensor histidine kinase n=1 Tax=...   142    3e-31 
  UniRef100_UPI0003954D64 histidine kinase n=1 Tax=Comamonas sp. ...   142    3e-31 
  UniRef100_G7CW50 Two-component system sensor histidine kinase n...   142    3e-31 
  UniRef100_C5ABG4 Osmolarity sensor protein EnvZ n=1 Tax=Burkhol...   142    3e-31 
  UniRef100_X5Q330 ATPase n=1 Tax=Mesorhizobium sp. LSJC280B00 Re...   142    3e-31 
  UniRef100_A3W3V4 Sensor histidine kinase n=1 Tax=Roseovarius sp...   142    3e-31 
  UniRef100_V7FLV8 ATPase n=1 Tax=Mesorhizobium sp. LSHC420B00 Re...   142    3e-31 
  UniRef100_G2FIJ4 Osmolarity sensor protein EnvZ n=1 Tax=endosym...   142    3e-31 
  UniRef100_W6B813 HAMP domain protein n=1 Tax=Burkholderia thail...   142    3e-31 
  UniRef100_A0NYJ1 Two-component hybrid sensor and regulator n=1 ...   142    3e-31 
  UniRef100_E0MJ38 Periplasmic sensor signal transduction histidi...   142    3e-31 
  UniRef100_UPI00031BDF11 ATPase n=1 Tax=Pseudaminobacter salicyl...   142    3e-31 
  UniRef100_I3UW87 Integral membrane sensor signal transduction h...   142    3e-31 
  UniRef100_R9UZQ4 Sensor histidine kinase n=2 Tax=Pseudomonas pu...   142    3e-31 
  UniRef100_UPI0003196BB5 sensor histidine kinase n=1 Tax=Burkhol...   142    4e-31 
  UniRef100_UPI00031953C1 sensor histidine kinase n=1 Tax=Pseudom...   142    4e-31 
  UniRef100_UPI00035ED048 ATPase n=1 Tax=Rhizobium meliloti RepID...   142    4e-31 
  UniRef100_B3PUY9 Probable two-component sensor histidine kinase...   142    4e-31 
  UniRef100_N9ALL3 Uncharacterized protein n=2 Tax=Acinetobacter ...   142    4e-31 
  UniRef100_M9RCJ8 Histidine kinase n=1 Tax=Octadecabacter antarc...   142    4e-31 
  UniRef100_UPI0002E5A247 sensor histidine kinase n=1 Tax=Pseudom...   142    4e-31 
  UniRef100_UPI0002EAF222 ATPase n=1 Tax=Rhizobium meliloti RepID...   142    4e-31 
  UniRef100_UPI000348AF46 ATPase n=1 Tax=Methylobacterium sp. 285...   142    4e-31 
  UniRef100_M3ADP4 Signal transduction histidine kinase n=1 Tax=M...   142    4e-31 
  UniRef100_F2AJ01 Putative two-component sensor histidine kinase...   142    4e-31 
  UniRef100_K8WV00 Two-component sensor protein n=1 Tax=Providenc...   142    4e-31 
  UniRef100_UPI00035CEF71 histidine kinase n=1 Tax=Acinetobacter ...   142    4e-31 
  UniRef100_F6BWJ5 Integral membrane sensor signal transduction h...   142    4e-31 
  UniRef100_F9SFU3 Signal transduction histidine kinase n=1 Tax=V...   142    4e-31 
  UniRef100_UPI00036E9D1A hypothetical protein n=1 Tax=Oligella u...   142    4e-31 
  UniRef100_A4VM92 Sensor histidine kinase n=3 Tax=Pseudomonas st...   142    4e-31 
  UniRef100_T0P1P5 Two-component sensor protein n=2 Tax=Photorhab...   142    4e-31 
  UniRef100_A3W800 Sensor histidine kinase (Fragment) n=1 Tax=Ros...   142    4e-31 
  UniRef100_UPI00037B957E hypothetical protein n=1 Tax=Hyphomicro...   142    4e-31 
  UniRef100_S2KH28 Integral membrane sensor signal transduction h...   142    5e-31 
  UniRef100_Q2T049 Osmolarity sensor protein EnvZ, putative n=3 T...   141    5e-31 
  UniRef100_UPI000378B5B7 hypothetical protein n=1 Tax=Bradyrhizo...   141    5e-31 
  UniRef100_N0AKZ5 HAMP domain protein n=1 Tax=Burkholderia thail...   141    5e-31 
  UniRef100_I7BVX7 Integral membrane sensor signal transduction n...   141    5e-31 
  UniRef100_U6EGY7 Osmolarity sensor protein EnvZ n=1 Tax=Rickett...   141    5e-31 
  UniRef100_UPI0003748645 hypothetical protein n=1 Tax=Methylobac...   141    5e-31 
  UniRef100_S6L6B4 Sensor histidine kinase n=1 Tax=Pseudomonas st...   141    5e-31 
  UniRef100_A0A017HGP9 Sensor histidine kinase n=1 Tax=Loktanella...   141    5e-31 
  UniRef100_A5VX50 Integral membrane sensor signal transduction h...   141    5e-31 
  UniRef100_UPI0003760368 histidine kinase n=1 Tax=Oceanimonas sm...   141    5e-31 
  UniRef100_UPI00035E61C5 hypothetical protein, partial n=1 Tax=X...   141    5e-31 
  UniRef100_X5LND9 Sensor histidine kinase EnvZ n=5 Tax=Bartonell...   141    5e-31 
  UniRef100_UPI0003B332BD ATPase n=1 Tax=Thalassospira lucentensi...   141    5e-31 
  UniRef100_E6Z0C1 Sensor histidine kinase n=1 Tax=Bartonella sch...   141    5e-31 
  UniRef100_T2H058 Putative two-component histidine kinase n=1 Ta...   141    5e-31 
  UniRef100_UPI0002EF9009 osmolarity sensor protein EnvZ n=1 Tax=...   141    5e-31 
  UniRef100_U4UY97 Signal transduction histidine kinase n=1 Tax=R...   141    5e-31 
  UniRef100_UPI00030C40C4 sensor histidine kinase n=1 Tax=Vibrio ...   141    5e-31 
  UniRef100_S3HXJ2 Two-component sensor histidine kinase n=1 Tax=...   141    6e-31 
  UniRef100_A3XEF3 Sensor histidine kinase n=1 Tax=Roseobacter sp...   141    6e-31 
  UniRef100_G9A8R7 Sensor histidine kinase n=1 Tax=Rhizobium fred...   141    6e-31 
  UniRef100_L9UAU2 ATPase-like, ATP-binding domain n=1 Tax=Halomo...   141    6e-31 
  UniRef100_UPI0003743EAD hypothetical protein n=1 Tax=Thiobacill...   141    6e-31 
  UniRef100_K2JBW4 Histidine kinase n=1 Tax=Celeribacter baekdone...   141    6e-31 
  UniRef100_J0W420 Signal transduction histidine kinase n=1 Tax=R...   141    6e-31 
  UniRef100_R7X289 Sensor histidine kinase in two-component regul...   141    6e-31 
  UniRef100_F0BEF2 Signal transduction histidine kinase n=1 Tax=X...   141    6e-31 
  UniRef100_U2T662 Sensor histidine kinase n=1 Tax=Pseudomonas pu...   141    6e-31 
  UniRef100_I0DUN2 Two-component sensor protein n=2 Tax=Providenc...   141    6e-31 
  UniRef100_UPI000360FADF ATPase n=1 Tax=Methylobacterium sp. 88A...   141    6e-31 
  UniRef100_UPI00037AE96E hypothetical protein n=1 Tax=Hirschia m...   141    6e-31 
  UniRef100_UPI0003797DBC ATPase n=1 Tax=Rhizobium meliloti RepID...   141    6e-31 
  UniRef100_Q83WV1 EnvZ (Fragment) n=1 Tax=Thiocapsa roseopersici...   141    6e-31 
  UniRef100_R7KJ84 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   141    6e-31 
  UniRef100_N9VQG7 Sensor histidine kinase n=1 Tax=Aeromonas dive...   141    6e-31 
  UniRef100_T2L115 Signal transduction histidine kinase n=1 Tax=H...   141    6e-31 
  UniRef100_B0UKF8 Integral membrane sensor signal transduction h...   141    7e-31 
  UniRef100_J1JX48 Uncharacterized protein n=2 Tax=Bartonella tam...   141    7e-31 
  UniRef100_A3TXM7 Sensor histidine kinase n=1 Tax=Oceanicola bat...   141    7e-31 
  UniRef100_K8WUF9 Two-component sensor protein n=1 Tax=Providenc...   141    7e-31 
  UniRef100_H0S979 Putative two component sensor histidine kinase...   141    7e-31 
  UniRef100_N9W1E5 Integral membrane sensor signal transduction n...   141    7e-31 
  UniRef100_A3YE12 Sensor histidine kinase n=1 Tax=Marinomonas sp...   141    7e-31 
  UniRef100_Q6G2M1 Sensor histidine kinase n=1 Tax=Bartonella hen...   141    7e-31 
  UniRef100_J0PKT0 Two component sensor histidine kinase n=1 Tax=...   141    7e-31 
  UniRef100_Q0BXM3 Sensor histidine kinase n=1 Tax=Hyphomonas nep...   141    7e-31 
  UniRef100_F2J0G3 ATPase, histidine kinase-, DNA gyrase B-, and ...   141    7e-31 
  UniRef100_UPI0002EC9316 histidine kinase n=1 Tax=Pseudomonas sp...   141    7e-31 
  UniRef100_D5VKX5 Integral membrane sensor signal transduction h...   141    7e-31 
  UniRef100_X4V5X6 Histidine kinase n=3 Tax=Bacteria RepID=X4V5X6...   141    8e-31 
  UniRef100_UPI0003686577 hypothetical protein, partial n=1 Tax=X...   140    8e-31 
  UniRef100_F7VAV9 Two component sensor histidine kinase EnvZ n=1...   140    8e-31 
  UniRef100_I4YPF0 Signal transduction histidine kinase n=1 Tax=M...   140    8e-31 
  UniRef100_N6UNG6 Sensor histidine kinase EnvZ n=1 Tax=Bartonell...   140    8e-31 
  UniRef100_Q1NBH1 Periplasmic sensor signal transduction histidi...   140    8e-31 
  UniRef100_X4UVF8 Histidine kinase n=2 Tax=Aeromonas hydrophila ...   140    9e-31 
  UniRef100_W0J5P5 Histidine kinase n=1 Tax=Opitutaceae bacterium...   140    9e-31 
  UniRef100_UPI00037C7172 histidine kinase n=1 Tax=Aeromonas hydr...   140    9e-31 
  UniRef100_B9R5M6 ATPase, histidine kinase-, DNA gyrase B-, and ...   140    9e-31 
  UniRef100_UPI000363F7E1 hypothetical protein n=1 Tax=Thioalkali...   140    9e-31 
  UniRef100_UPI00035DFB2C sensor histidine kinase n=1 Tax=Pseudom...   140    9e-31 
  UniRef100_G0AJ86 Periplasmic sensor signal transduction histidi...   140    9e-31 
  UniRef100_UPI0002FF2966 sensor histidine kinase n=1 Tax=Pseudom...   140    9e-31 
  UniRef100_UPI0003618599 histidine kinase n=1 Tax=Aeromonas sp. ...   140    9e-31 
  UniRef100_E8RQE5 Integral membrane sensor signal transduction h...   140    9e-31 
  UniRef100_B1LTS9 Integral membrane sensor signal transduction h...   140    9e-31 
  UniRef100_UPI00036C7648 hypothetical protein n=1 Tax=Duganella ...   140    1e-30 
  UniRef100_UPI0003017CBC hypothetical protein n=1 Tax=Pseudomona...   140    1e-30 
  UniRef100_J3HSB1 Signal transduction histidine kinase n=1 Tax=P...   140    1e-30 
  UniRef100_K2J2C5 Signal transduction histidine kinase n=1 Tax=A...   140    1e-30 
  UniRef100_F5M1G7 Signal transduction kinase protein n=1 Tax=Rho...   140    1e-30 
  UniRef100_S7IG79 Integral membrane sensor signal transduction h...   140    1e-30 
  UniRef100_V6UVF7 Sensor histidine kinase (Fragment) n=1 Tax=Pse...   140    1e-30 
  UniRef100_L1K625 Sensor histidine kinase n=1 Tax=Rhodobacter sp...   140    1e-30 
  UniRef100_K0DMD6 Two-component system, OmpR family, osmolarity ...   140    1e-30 
  UniRef100_A3UFQ8 Sensor histidine kinase n=1 Tax=Oceanicaulis s...   140    1e-30 
  UniRef100_UPI000288AD39 ATPase n=1 Tax=Rickettsia helvetica Rep...   140    1e-30 
  UniRef100_Q3J1G0 Signal transduction kinase protein n=1 Tax=Rho...   140    1e-30 
  UniRef100_M7QYZ0 Integral membrane sensor signal transduction n...   140    1e-30 
  UniRef100_UPI00036FDC67 hypothetical protein n=1 Tax=Methylocys...   140    1e-30 
  UniRef100_F7YLT3 Sensory transduction histidine kinase n=2 Tax=...   140    1e-30 
  UniRef100_A4STF5 Two-component system sensor histidine kinase n...   140    1e-30 
  UniRef100_A0KEK8 Signal transduction histidine kinase n=1 Tax=A...   140    1e-30 
  UniRef100_R4VAG1 Signal transduction histidine kinase n=2 Tax=A...   140    1e-30 
  UniRef100_A7IIF8 Integral membrane sensor signal transduction h...   140    1e-30 
  UniRef100_T0P7N4 Two-component system sensor histidine kinase n...   140    1e-30 
  UniRef100_J0PR26 Uncharacterized protein n=1 Tax=Bartonella bir...   140    1e-30 
  UniRef100_A5KYM3 Signal transduction histidine kinase n=1 Tax=V...   140    1e-30 
  UniRef100_Q89NX8 Two-component hybrid sensor and regulator n=1 ...   140    1e-30 
  UniRef100_A1UTG5 Sensor histidine kinase n=5 Tax=Bartonella bac...   140    1e-30 
  UniRef100_V9WLA6 Signal transduction histidine kinase n=1 Tax=P...   140    1e-30 
  UniRef100_W4L9B5 Uncharacterized protein (Fragment) n=1 Tax=Can...   140    1e-30 
  UniRef100_UPI0002E47BD4 sensor histidine kinase n=1 Tax=Vibrio ...   140    1e-30 
  UniRef100_V2K0M1 Histidine kinase n=1 Tax=Cupriavidus sp. HPC(L...   140    1e-30 
  UniRef100_L0LP67 Integral membrane sensor signal transduction h...   140    1e-30 
  UniRef100_N8WTF6 Uncharacterized protein n=1 Tax=Acinetobacter ...   140    1e-30 
  UniRef100_E5ATD2 Osmolarity sensor protein envZ (EC 2.7.3.-) n=...   140    1e-30 
  UniRef100_N8XV33 Uncharacterized protein n=1 Tax=Acinetobacter ...   140    1e-30 
  UniRef100_UPI0002FE13B2 sensor histidine kinase n=1 Tax=Pseudom...   140    1e-30 
  UniRef100_B4R8E4 Sensor histidine kinase n=1 Tax=Phenylobacteri...   140    1e-30 
  UniRef100_C4YZ57 Osmolarity sensor protein EnvZ n=1 Tax=Rickett...   140    1e-30 
  UniRef100_B7RIN2 Sensor histidine kinase n=1 Tax=Roseobacter sp...   140    1e-30 
  UniRef100_UPI00031CB9FE histidine kinase n=1 Tax=Komagataeibact...   140    1e-30 
  UniRef100_A3VXA9 Sensor histidine kinase n=1 Tax=Roseovarius sp...   140    1e-30 
  UniRef100_I4CUS1 Sensor histidine kinase n=1 Tax=Pseudomonas st...   140    2e-30 
  UniRef100_E7RW96 LPXTG-motif cell wall anchor domain protein n=...   140    2e-30 
  UniRef100_UPI0003645D3A hypothetical protein n=1 Tax=Pannonibac...   140    2e-30 
  UniRef100_E6YGM2 Sensor histidine kinase n=1 Tax=Bartonella cla...   140    2e-30 
  UniRef100_V7E6M5 Signal transduction histidine kinase n=1 Tax=P...   140    2e-30 
  UniRef100_F1W041 Osmolarity sensory histidine kinase EnvZ n=1 T...   140    2e-30 
  UniRef100_X5MHX5 Sensor histidine kinase EnvZ n=1 Tax=Bartonell...   140    2e-30 
  UniRef100_H6SL51 Sensor protein n=1 Tax=Rhodospirillum photomet...   140    2e-30 
  UniRef100_B9R2A1 ATPase, histidine kinase-, DNA gyrase B-, and ...   140    2e-30 
  UniRef100_W0A7D8 Signal transduction histidine kinase n=1 Tax=A...   140    2e-30 
  UniRef100_UPI00036603F5 sensor histidine kinase n=1 Tax=Burkhol...   140    2e-30 
  UniRef100_V4QHZ4 Sensor histidine kinase n=1 Tax=Pseudomonas ch...   140    2e-30 
  UniRef100_J0PX52 Uncharacterized protein n=1 Tax=Bartonella sp....   140    2e-30 
  UniRef100_UPI00016A51FA osmolarity sensor protein EnvZ n=1 Tax=...   140    2e-30 
  UniRef100_UPI00037B5ED3 hypothetical protein n=1 Tax=Elioraea t...   139    2e-30 
  UniRef100_R1GNG5 Integral membrane sensor signal transduction h...   139    2e-30 
  UniRef100_W0SN11 Integral membrane sensor signal transduction h...   139    2e-30 
  UniRef100_E6YPU7 Sensor histidine kinase n=1 Tax=Bartonella sp....   139    2e-30 
  UniRef100_UPI000361F1E9 sensor histidine kinase n=1 Tax=Pseudom...   139    2e-30 
  UniRef100_G8PMB1 Two component system sensor histidine kinase n...   139    2e-30 
  UniRef100_A1VTZ4 Integral membrane sensor signal transduction h...   139    2e-30 
  UniRef100_L8JCH1 Integral membrane sensor signal transduction h...   139    2e-30 
  UniRef100_UPI000237E63B histidine kinase n=1 Tax=Komagataeibact...   139    2e-30 
  UniRef100_N6VD68 Sensor histidine kinase EnvZ n=1 Tax=Bartonell...   139    2e-30 
  UniRef100_G2TDT9 Periplasmic sensor Signal transduction histidi...   139    2e-30 
  UniRef100_G9ZYW7 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   139    2e-30 
  UniRef100_D5CMB0 Integral membrane sensor signal transduction h...   139    2e-30 
  UniRef100_A4YZM5 Putative two component sensor histidine kinase...   139    2e-30 
  UniRef100_A0KQ48 Sensor histidine kinase n=1 Tax=Aeromonas hydr...   139    2e-30 
  UniRef100_Q1YEY0 Putative ATPase-like histidine kinase n=1 Tax=...   139    2e-30 
  UniRef100_UPI0002260C9B sensor histidine kinase n=1 Tax=Acetoba...   139    2e-30 
  UniRef100_R4VL73 Sensor histidine kinase n=2 Tax=Aeromonas hydr...   139    2e-30 
  UniRef100_UPI0003638B78 histidine kinase n=1 Tax=Loktanella ves...   139    2e-30 
  UniRef100_G3ABA5 Putative sensory histidine kinase in two-compo...   139    2e-30 
  UniRef100_R1H7Z3 Signal transduction histidine kinase n=1 Tax=A...   139    2e-30 
  UniRef100_K2LJX6 Signal transduction histidine kinase n=1 Tax=T...   139    2e-30 
  UniRef100_C8S1S9 Histidine kinase n=1 Tax=Rhodobacter sp. SW2 R...   139    2e-30 
  UniRef100_B7KNM1 Histidine kinase n=2 Tax=Methylobacterium exto...   139    2e-30 
  UniRef100_D4C5C3 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   139    2e-30 
  UniRef100_B5ZY35 Integral membrane sensor signal transduction h...   139    2e-30 
  UniRef100_E8YGS1 Integral membrane sensor signal transduction h...   139    2e-30 
  UniRef100_UPI00036C3867 hypothetical protein n=1 Tax=Kiloniella...   139    2e-30 
  UniRef100_H1KCT5 Integral membrane sensor signal transduction h...   139    2e-30 
  UniRef100_UPI00035C6B2D sensor histidine kinase n=1 Tax=Burkhol...   139    2e-30 
  UniRef100_E1TBL8 Integral membrane sensor signal transduction h...   139    2e-30 
  UniRef100_UPI00036118A3 ATPase n=1 Tax=Methylobacterium sp. 77 ...   139    2e-30 
  UniRef100_Q0BU66 Two component system histidine kinase n=2 Tax=...   139    2e-30 
  UniRef100_G0JRE4 Integral membrane sensor signal transduction h...   139    2e-30 
  UniRef100_J7QL06 Integral membrane sensor signal transduction h...   139    2e-30 
  UniRef100_UPI00037757D3 hypothetical protein n=1 Tax=Sphingomon...   139    2e-30 
  UniRef100_F2IV94 ATPase, histidine kinase-, DNA gyrase B-, and ...   139    2e-30 
  UniRef100_A5V8H7 Integral membrane sensor signal transduction h...   139    3e-30 
  UniRef100_UPI000301B0C5 sensor histidine kinase n=1 Tax=Vibrio ...   139    3e-30 
  UniRef100_B5WDK0 Integral membrane sensor signal transduction h...   139    3e-30 
  UniRef100_G2ILS8 Two-component system sensor histidine kinase n...   139    3e-30 
  UniRef100_B1ZCE6 Integral membrane sensor signal transduction h...   139    3e-30 
  UniRef100_F0L8H0 Two component sensor histidine kinase n=3 Tax=...   139    3e-30 
  UniRef100_D2UCZ0 Probable two-component system sensor protein, ...   139    3e-30 
  UniRef100_R0ECY1 Sensor histidine kinase n=1 Tax=Herbaspirillum...   139    3e-30 
  UniRef100_UPI00016AFF76 osmolarity sensor protein EnvZ n=1 Tax=...   139    3e-30 
  UniRef100_V6MH32 Two-component sensor protein n=1 Tax=Proteus h...   139    3e-30 
  UniRef100_J2U4I3 Signal transduction histidine kinase n=1 Tax=P...   139    3e-30 
  UniRef100_M4XEI7 Two-component sensor n=1 Tax=Pseudomonas denit...   139    3e-30 
  UniRef100_UPI0003B68DF7 histidine kinase n=1 Tax=Paracoccus zea...   139    3e-30 
  UniRef100_J3HWS8 Signal transduction histidine kinase n=1 Tax=B...   139    3e-30 
  UniRef100_Q142Z0 Periplasmic Sensor Signal Transduction Histidi...   139    3e-30 
  UniRef100_UPI000373A5F7 hypothetical protein n=1 Tax=alpha prot...   139    3e-30 
  UniRef100_I0G3A9 Two-component hybrid sensor and regulator n=1 ...   139    3e-30 
  UniRef100_A1B2X4 Integral membrane sensor signal transduction h...   139    3e-30 
  UniRef100_G0A5E1 Integral membrane sensor signal transduction h...   139    3e-30 
  UniRef100_S3NNF7 Two-component system, OmpR family, sensor hist...   139    3e-30 
  UniRef100_A0A023D4U2 Two component sensor histidine kinase EnvZ...   139    3e-30 
  UniRef100_B8EM48 Integral membrane sensor signal transduction h...   139    3e-30 
  UniRef100_A0LD24 Periplasmic sensor signal transduction histidi...   139    3e-30 
  UniRef100_UPI0003692DDC ATPase n=1 Tax=Rhizobium sp. 42MFCr.1 R...   139    3e-30 
  UniRef100_V4RFH1 Sensor histidine kinase n=1 Tax=Lutibaculum ba...   139    3e-30 
  UniRef100_I2IPD5 Signal transduction histidine kinase n=1 Tax=B...   139    3e-30 
  UniRef100_UPI00038245CE hypothetical protein n=1 Tax=Curvibacte...   139    3e-30 
  UniRef100_N6UL44 Sensor histidine kinase EnvZ n=1 Tax=Bartonell...   139    3e-30 
  UniRef100_UPI0003B2F36C sensor histidine kinase n=1 Tax=Psychro...   139    4e-30 
  UniRef100_UPI000372B3D5 ATPase n=1 Tax=Rhizobium leguminosarum ...   139    4e-30 
  UniRef100_UPI00036EB19E hypothetical protein n=1 Tax=Methylover...   139    4e-30 
  UniRef100_U4PVL3 Putative two-component sensor histidine kinase...   139    4e-30 
  UniRef100_UPI0003649B3B hypothetical protein n=1 Tax=Robiginito...   139    4e-30 
  UniRef100_H0J2R5 Periplasmic sensor signal transduction histidi...   139    4e-30 
  UniRef100_N9HAQ0 Uncharacterized protein n=2 Tax=Bacteria RepID...   139    4e-30 
  UniRef100_K5BZ07 Two component sensor kinase n=1 Tax=Rhizobium ...   139    4e-30 
  UniRef100_D5W4T8 Integral membrane sensor signal transduction h...   139    4e-30 
  UniRef100_N9PHF5 Uncharacterized protein n=1 Tax=Acinetobacter ...   139    4e-30 
  UniRef100_L7C157 Sensor histidine kinase n=1 Tax=Pantoea agglom...   139    4e-30 
  UniRef100_B8H3T5 Two-component sensor histidine kinase n=2 Tax=...   138    4e-30 
  UniRef100_K9CNF3 Uncharacterized protein n=1 Tax=Sphingobium ya...   138    4e-30 
  UniRef100_UPI000317E038 sensor histidine kinase n=1 Tax=Vibrio ...   138    4e-30 
  UniRef100_UPI000311E5C4 histidine kinase n=1 Tax=Aeromonas hydr...   138    4e-30 
  UniRef100_H0TEU1 Putative two component sensor histidine kinase...   138    4e-30 
  UniRef100_I0G288 Two-component hybrid sensor and regulator n=1 ...   138    4e-30 
  UniRef100_N9GAR4 Uncharacterized protein n=1 Tax=Acinetobacter ...   138    4e-30 
  UniRef100_I4ZNR8 Sensor protein rstB n=1 Tax=Acinetobacter sp. ...   138    4e-30 
  UniRef100_E6YKM9 Sensor histidine kinase n=1 Tax=Bartonella roc...   138    4e-30 
  UniRef100_M7Y7Z1 Integral membrane sensor signal transduction h...   138    4e-30 
  UniRef100_M4Z473 Two-component sensor histidine kinase n=1 Tax=...   138    4e-30 
  UniRef100_UPI000368CDA2 ATPase n=1 Tax=Rhizobium leguminosarum ...   138    4e-30 
  UniRef100_E6YUD7 Sensor histidine kinase n=1 Tax=Bartonella sp....   138    5e-30 
  UniRef100_U1LLF8 Sensor protein RstB n=1 Tax=Pseudoalteromonas ...   138    5e-30 
  UniRef100_G9YB05 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   138    5e-30 
  UniRef100_A0A017HSD8 Sensor histidine kinase n=1 Tax=Rubellimic...   138    5e-30 
  UniRef100_UPI00037E896D ATPase n=1 Tax=Methylocystis rosea RepI...   138    5e-30 
  UniRef100_T2L998 Sensor protein rstB n=1 Tax=Halomonas sp. A3H3...   138    5e-30 
  UniRef100_K5EK75 Sensor protein rstB n=1 Tax=Escherichia coli 5...   138    5e-30 
  UniRef100_A0A016XHI2 Histidine kinase n=1 Tax=Hylemonella graci...   138    5e-30 
  UniRef100_UPI00030829A3 sensor histidine kinase n=1 Tax=Vibrio ...   138    5e-30 
  UniRef100_Q3SGE4 Periplasmic Sensor Signal Transduction Histidi...   138    5e-30 
  UniRef100_M5EXA4 Sensor protein n=1 Tax=Mesorhizobium metallidu...   138    5e-30 
  UniRef100_J6DQU9 Two-component sensor histidine kinase n=1 Tax=...   138    5e-30 
  UniRef100_UPI0002E93021 histidine kinase n=1 Tax=Acinetobacter ...   138    5e-30 
  UniRef100_G6XIH3 Osmolarity sensor protein envZ n=1 Tax=Glucono...   138    5e-30 
  UniRef100_UPI00035D6090 ATPase n=1 Tax=Rhizobium leguminosarum ...   138    5e-30 
  UniRef100_A1B7L5 Histidine kinase n=1 Tax=Paracoccus denitrific...   138    5e-30 
  UniRef100_U5A0K1 Integral membrane sensor signal transduction h...   138    5e-30 
  UniRef100_UPI00021985B2 sensor histidine kinase n=1 Tax=Aeromon...   138    5e-30 
  UniRef100_Q7NTF1 Probable two-component sensor histidine kinase...   138    5e-30 
  UniRef100_G8AEG5 Putative signal transduction histidine kinase ...   138    5e-30 
  UniRef100_K0Q2C9 Sensor protein n=1 Tax=Rhizobium mesoamericanu...   138    5e-30 
  UniRef100_A0A011UE43 ATPase n=1 Tax=Aquamicrobium defluvii RepI...   138    5e-30 
  UniRef100_Q1LHM8 Periplasmic sensor signal transduction histidi...   138    5e-30 
  UniRef100_W6IDF9 Uncharacterized protein n=1 Tax=Granulibacter ...   138    6e-30 
  UniRef100_T0HA84 Histidine kinase n=1 Tax=Sphingobium quisquili...   138    6e-30 
  UniRef100_K2M5U5 Signal transduction histidine kinase n=1 Tax=T...   138    6e-30 
  UniRef100_UPI0002FFE9F9 sensor histidine kinase n=1 Tax=Vibrio ...   138    6e-30 
  UniRef100_UPI00036CCA27 ATPase n=1 Tax=Rhizobium leguminosarum ...   138    6e-30 
  UniRef100_J7U7A3 Copper sensory histidine kinase CpxA n=4 Tax=M...   138    6e-30 
  UniRef100_B4RDC5 Sensor histidine kinase n=1 Tax=Phenylobacteri...   138    6e-30 
  UniRef100_N9PCC5 Uncharacterized protein n=1 Tax=Acinetobacter ...   138    6e-30 
  UniRef100_UPI0002198572 histidine kinase n=1 Tax=Aeromonas cavi...   138    6e-30 
  UniRef100_J9YVD2 Histidine kinase with HAMP domain protein n=1 ...   138    6e-30 
  UniRef100_Q1ZWY2 Putative Signal transduction histidine kinase ...   138    6e-30 
  UniRef100_UPI0003034A10 sensor histidine kinase n=1 Tax=Vibrio ...   138    6e-30 
  UniRef100_UPI0002D62EF7 sensor histidine kinase n=1 Tax=Vibrio ...   138    6e-30 
  UniRef100_E0LSM2 Integral membrane sensor signal transduction h...   138    6e-30 
  UniRef100_W0N6F7 ATPase n=1 Tax=Rhizobium leguminosarum bv. tri...   138    6e-30 
  UniRef100_Q7P1J6 Protein histidine kinase/phosphatase sensor fo...   138    6e-30 
  UniRef100_J0C315 Signal transduction histidine kinase n=1 Tax=R...   138    6e-30 
  UniRef100_E5YJ73 Uncharacterized protein n=1 Tax=Enterobacteria...   138    6e-30 
  UniRef100_B1FY24 Integral membrane sensor signal transduction h...   138    6e-30 
  UniRef100_F3LLW4 Putative oxidative stress resistance two-compo...   138    7e-30 
  UniRef100_UPI000288F520 histidine kinase n=1 Tax=Halomonas sp. ...   138    7e-30 
  UniRef100_UPI00036E9A01 sensor histidine kinase n=1 Tax=Vibrio ...   137    7e-30 
  UniRef100_C6ASZ6 Histidine kinase n=1 Tax=Rhizobium leguminosar...   137    7e-30 
  UniRef100_Q98HX5 Probable two-component sensor n=1 Tax=Rhizobiu...   137    7e-30 
  UniRef100_UPI00036C2C02 MULTISPECIES: ATPase n=1 Tax=Rhizobium ...   137    7e-30 
  UniRef100_K9HFW4 Uncharacterized protein n=1 Tax=Caenispirillum...   137    7e-30 
  UniRef100_H0RW63 Putative two component sensor histidine kinase...   137    7e-30 
  UniRef100_UPI00035CC0F2 sensor histidine kinase n=1 Tax=Burkhol...   137    7e-30 
  UniRef100_U2ZY32 Putative two-component histidine kinase n=1 Ta...   137    7e-30 
  UniRef100_X2K6P2 Histidine kinase n=1 Tax=Pandoraea pnomenusa R...   137    7e-30 
  UniRef100_Q21SA6 Periplasmic sensor signal transduction histidi...   137    7e-30 
  UniRef100_UPI00037166AD sensor histidine kinase n=1 Tax=Vibrio ...   137    8e-30 
  UniRef100_T0HQL8 Histidine kinase n=1 Tax=Novosphingobium linda...   137    8e-30 
  UniRef100_A0A009FKZ2 HAMP domain protein n=1 Tax=Acinetobacter ...   137    8e-30 
  UniRef100_F4HCM4 Two-component sensor protein n=1 Tax=Gallibact...   137    8e-30 
  UniRef100_U3HQJ4 Sensor histidine kinase n=1 Tax=Pseudomonas st...   137    8e-30 
  UniRef100_V5UBH5 Histidine kinase n=1 Tax=Pandoraea sp. RB-44 R...   137    8e-30 
  UniRef100_A6UBP8 Integral membrane sensor signal transduction h...   137    8e-30 
  UniRef100_W9DYH8 Signal transduction histidine kinase n=1 Tax=C...   137    8e-30 
  UniRef100_N9ME27 Uncharacterized protein n=1 Tax=Acinetobacter ...   137    8e-30 
  UniRef100_K8W2S3 Two-component sensor protein n=1 Tax=Providenc...   137    8e-30 
  UniRef100_W3V9W6 Signal transduction histidine kinase n=1 Tax=P...   137    8e-30 
  UniRef100_L2EGE2 Periplasmic sensor signal transduction histidi...   137    8e-30 
  UniRef100_I2QP58 Signal transduction histidine kinase n=1 Tax=B...   137    8e-30 
  UniRef100_B1ZC73 Integral membrane sensor signal transduction h...   137    9e-30 
  UniRef100_N9VNQ4 Signal transduction histidine kinase n=1 Tax=A...   137    9e-30 
  UniRef100_R6J239 Signal transduction histidine kinase n=1 Tax=A...   137    9e-30 
  UniRef100_UPI000287E800 histidine kinase n=1 Tax=Pseudomonas sp...   137    9e-30 
  UniRef100_D8N1P6 Putative sensory histidine kinase in two-compo...   137    9e-30 
  UniRef100_I6AQF5 Signal transduction histidine kinase n=1 Tax=O...   137    9e-30 
  UniRef100_N6V004 Signal transduction histidine-protein kinase B...   137    9e-30 
  UniRef100_V4NFG9 Histidine kinase n=1 Tax=Asticcacaulis sp. YBE...   137    9e-30 
  UniRef100_L9PDA3 Osmolarity sensor protein EnvZ n=1 Tax=Janthin...   137    9e-30 
  UniRef100_W0ITQ2 Histidine kinase n=1 Tax=Opitutaceae bacterium...   137    9e-30 
  UniRef100_UPI0001817418 membrane protein n=1 Tax=Ralstonia sola...   137    1e-29 
  UniRef100_U9BF51 Two-component system sensor n=1 Tax=Pseudomona...   137    1e-29 
  UniRef100_W6I0T4 Uncharacterized protein n=1 Tax=Granulibacter ...   137    1e-29 
  UniRef100_G2FG78 Osmolarity sensor protein EnvZ n=2 Tax=sulfur-...   137    1e-29 
  UniRef100_L0GKC8 Signal transduction histidine kinase n=1 Tax=P...   137    1e-29 
  UniRef100_L0EVD2 Osmolarity sensor protein EnvZ n=1 Tax=Liberib...   137    1e-29 
  UniRef100_D0Z3K9 Signal transduction histidine kinase n=1 Tax=P...   137    1e-29 
  UniRef100_V5PP63 Histidine kinase n=1 Tax=Pandoraea pnomenusa 3...   137    1e-29 
  UniRef100_A8LTD6 Two component integral membrane sensor signal ...   137    1e-29 
  UniRef100_A3VJ31 Sensor histidine kinase n=1 Tax=Maritimibacter...   137    1e-29 
  UniRef100_UPI00035D7E03 hypothetical protein n=1 Tax=Caulobacte...   137    1e-29 
  UniRef100_UPI000376C0D8 hypothetical protein n=1 Tax=Pseudomona...   137    1e-29 
  UniRef100_UPI00036DA266 hypothetical protein n=1 Tax=Kaistia gr...   137    1e-29 
  UniRef100_K0VX40 Two-component sensor histidine kinase n=1 Tax=...   137    1e-29 
  UniRef100_J2VPR2 Signal transduction histidine kinase n=1 Tax=H...   137    1e-29 
  UniRef100_UPI0003145ACF histidine kinase n=1 Tax=Acidovorax ave...   137    1e-29 
  UniRef100_UPI000376F9E1 hypothetical protein n=1 Tax=Chelatococ...   137    1e-29 
  UniRef100_UPI0003702B8B ATPase n=1 Tax=Rhizobium leguminosarum ...   137    1e-29 
  UniRef100_G2E7I7 Integral membrane sensor signal transduction h...   137    1e-29 
  UniRef100_UPI00036EFD56 ATPase n=1 Tax=Rhizobium giardinii RepI...   137    1e-29 
  UniRef100_Q89FP7 Two-component hybrid sensor and regulator n=1 ...   137    1e-29 
  UniRef100_M4Z454 Two-component sensor histidine kinase n=1 Tax=...   137    1e-29 
  UniRef100_A0A022PFE4 Signal transduction histidine kinase n=1 T...   137    1e-29 
  UniRef100_G0CFS2 Two-component system sensor protein n=1 Tax=Xa...   137    1e-29 
  UniRef100_Q0FZB1 Sensor histidine kinase n=1 Tax=Fulvimarina pe...   137    1e-29 
  UniRef100_J2FZ37 Signal transduction histidine kinase n=1 Tax=C...   137    1e-29 
  UniRef100_Q7MY93 Two-component sensor kinase n=1 Tax=Photorhabd...   137    1e-29 
  UniRef100_UPI0003768F73 hypothetical protein n=1 Tax=Methylofer...   136    1e-29 
  UniRef100_E8VNA8 Integral membrane sensor signal transduction h...   136    1e-29 
  UniRef100_H1KJX9 Integral membrane sensor signal transduction h...   136    2e-29 
  UniRef100_A9HS38 Putative sensor signal transduction histidine ...   136    2e-29 
  UniRef100_U2YNR0 Putative two-component histidine kinase n=1 Ta...   136    2e-29 
  UniRef100_B5ZL73 Integral membrane sensor signal transduction h...   136    2e-29 
  UniRef100_UPI000381C174 histidine kinase n=1 Tax=Bradyrhizobium...   136    2e-29 
  UniRef100_UPI0003777F06 histidine kinase n=1 Tax=Pantoea sp. A4...   136    2e-29 
  UniRef100_Q8DG14 Signal transduction histidine kinase n=1 Tax=V...   136    2e-29 
  UniRef100_UPI0003056D34 sensor histidine kinase n=1 Tax=Vibrio ...   136    2e-29 
  UniRef100_UPI0003AB4920 sensor histidine kinase n=1 Tax=Pseudom...   136    2e-29 
  UniRef100_A9W5X1 ATP-binding region ATPase domain protein n=1 T...   136    2e-29 
  UniRef100_I6SI14 Sensor protein RstB n=1 Tax=Enterobacter cloac...   136    2e-29 
  UniRef100_UPI0002D65C0D hypothetical protein n=1 Tax=Methylococ...   136    2e-29 
  UniRef100_E8TJ15 ATP-binding region ATPase domain protein n=1 T...   136    2e-29 
  UniRef100_B0RNV8 Two-component system sensor histidine kinase n...   136    2e-29 
  UniRef100_M9W329 Sensor protein RstB n=2 Tax=Enterobacteriaceae...   136    2e-29 
  UniRef100_B5ERL1 Integral membrane sensor signal transduction h...   136    2e-29 
  UniRef100_W1JRC1 Two-component hybrid sensor and regulator n=1 ...   136    2e-29 
  UniRef100_H0HPA3 ATPase domain-containing protein n=1 Tax=Mesor...   136    2e-29 
  UniRef100_U2EM83 Two-component hybrid sensor protein n=1 Tax=Sa...   136    2e-29 
  UniRef100_UPI0003824312 ATPase n=1 Tax=Methylocystis parvus Rep...   136    2e-29 
  UniRef100_G7DDQ6 Two-component hybrid sensor and regulator n=1 ...   136    2e-29 
  UniRef100_UPI0003610812 histidine kinase n=1 Tax=Proteus mirabi...   136    2e-29 
  UniRef100_UPI00035EFC16 hypothetical protein n=1 Tax=Oxalobacte...   136    2e-29 
  UniRef100_W0IJX0 ATPase n=1 Tax=Rhizobium leguminosarum bv. tri...   136    2e-29 
  UniRef100_Q1BUL4 Periplasmic sensor signal transduction histidi...   136    2e-29 
  UniRef100_UPI000348A0FC sensor histidine kinase n=1 Tax=Janthin...   136    2e-29 
  UniRef100_W1L310 ATPase n=1 Tax=Agrobacterium radiobacter DSM 3...   136    2e-29 
  UniRef100_M8A6G4 Two component sensor kinase n=1 Tax=Agrobacter...   136    2e-29 
  UniRef100_N2KXY4 Sensor protein rstB n=1 Tax=Escherichia coli 2...   136    2e-29 
  UniRef100_UPI00037AA6BD hypothetical protein n=1 Tax=Loktanella...   136    2e-29 
  UniRef100_UPI000225AF79 sensor histidine kinase, putative n=1 T...   136    2e-29 
  UniRef100_F4TGF3 Sensor protein RstB n=2 Tax=Escherichia coli R...   136    2e-29 
  UniRef100_Q0FU96 Sensor histidine kinase n=1 Tax=Pelagibaca ber...   136    2e-29 
  UniRef100_C4UFJ1 Putative uncharacterized protein n=1 Tax=Yersi...   136    2e-29 
  UniRef100_B9J777 Two-component sensor histidine kinase protein ...   136    2e-29 
  UniRef100_F6GA19 Two component transmembrane sensor kinase prot...   136    2e-29 
  UniRef100_S2KQ21 Uncharacterized protein n=1 Tax=Halomonas anti...   136    2e-29 
  UniRef100_Q1MDN6 Putative two-component sensor histidine kinase...   136    2e-29 
  UniRef100_UPI0002E481D8 sensor histidine kinase n=1 Tax=Vibrio ...   136    2e-29 
  UniRef100_T9M5Y1 Sensor protein rstB n=2 Tax=Escherichia coli R...   136    2e-29 
  UniRef100_L4IT94 Sensor protein rstB n=1 Tax=Escherichia coli K...   136    2e-29 
  UniRef100_UPI000262BEE3 histidine kinase n=1 Tax=Sphingobium ya...   136    2e-29 
  UniRef100_J8T2E7 CpxA n=1 Tax=Pectobacterium wasabiae CFBP 3304...   136    2e-29 
  UniRef100_J1K1V9 Uncharacterized protein n=1 Tax=Bartonella mel...   136    2e-29 
  UniRef100_S7IAN8 Integral membrane sensor signal transduction h...   136    2e-29 
  UniRef100_J2B264 Signal transduction histidine kinase n=1 Tax=R...   136    2e-29 
  UniRef100_B1ZBJ7 Integral membrane sensor signal transduction h...   136    2e-29 
  UniRef100_E2QMH2 Sensor protein rstB n=36 Tax=Escherichia coli ...   136    2e-29 
  UniRef100_B9JGX3 Two-component sensor histidine kinase protein ...   136    2e-29 
  UniRef100_J0BCR0 Signal transduction histidine kinase n=1 Tax=R...   136    2e-29 
  UniRef100_UPI00037493BD ATPase n=1 Tax=Rhizobium leguminosarum ...   135    3e-29 
  UniRef100_S3N8A3 Two-component system, OmpR family, sensor hist...   135    3e-29 
  UniRef100_D8BKS5 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   135    3e-29 
  UniRef100_V5ERB8 Putative Signal transduction histidine kinase ...   135    3e-29 
  UniRef100_Q60AS3 Sensor histidine kinase n=1 Tax=Methylococcus ...   135    3e-29 
  UniRef100_D4HUC3 Two-component sensor kinase n=12 Tax=Erwinia a...   135    3e-29 
  UniRef100_H0RQ15 Putative two-component sensor histidine kinase...   135    3e-29 
  UniRef100_G7TD44 Two-component system sensor protein n=1 Tax=Xa...   135    3e-29 
  UniRef100_UPI0003695022 hypothetical protein n=1 Tax=Lamprocyst...   135    3e-29 
  UniRef100_A0A009DU96 Sensor protein RstB n=3 Tax=Escherichia co...   135    3e-29 
  UniRef100_N9B9G9 Uncharacterized protein n=1 Tax=Acinetobacter ...   135    3e-29 
  UniRef100_R6I2Q6 Signal transduction histidine kinase n=1 Tax=A...   135    3e-29 
  UniRef100_J7QGX0 Putative two component Signal transduction his...   135    3e-29 
  UniRef100_U5NAQ6 Signal transduction histidine kinase n=1 Tax=C...   135    3e-29 
  UniRef100_F6EXJ7 Integral membrane sensor signal transduction h...   135    3e-29 
  UniRef100_G6EYW1 Osmosensitive K+ channel histidine kinase n=1 ...   135    3e-29 
  UniRef100_C6DHJ7 Histidine kinase n=2 Tax=Pectobacterium caroto...   135    3e-29 
  UniRef100_G6XRD9 Two component sensor kinase n=1 Tax=Agrobacter...   135    3e-29 
  UniRef100_S1G6Q3 Sensor protein rstB n=1 Tax=Escherichia coli K...   135    3e-29 
  UniRef100_UPI00037154DA hypothetical protein n=1 Tax=Gallibacte...   135    3e-29 
  UniRef100_B4F154 Two-component system sensor kinase n=2 Tax=Pro...   135    3e-29 
  UniRef100_T1A922 Two-component sensor histidine kinase n=1 Tax=...   135    3e-29 
  UniRef100_X6CXL1 ATPase n=1 Tax=Mesorhizobium sp. LNHC252B00 Re...   135    3e-29 
  UniRef100_S5RZ81 Sensor histidine kinase protein n=2 Tax=Rhizob...   135    3e-29 
  UniRef100_UPI00037092E3 ATPase n=1 Tax=Rhizobium leguminosarum ...   135    3e-29 
  UniRef100_M2VJK2 Sensor histidine kinase n=1 Tax=Pseudomonas st...   135    3e-29 
  UniRef100_L3DDE2 Sensor protein rstB n=18 Tax=Escherichia coli ...   135    3e-29 
  UniRef100_UPI000288A324 histidine kinase n=1 Tax=Pseudomonas fu...   135    3e-29 
  UniRef100_K1HJ12 Sensor protein CpxA n=2 Tax=Gammaproteobacteri...   135    3e-29 
  UniRef100_D8AD83 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   135    3e-29 
  UniRef100_UPI00035F9D73 ATPase n=1 Tax=Rhizobium loti RepID=UPI...   135    3e-29 
  UniRef100_E0QY42 Sensor protein RstB n=3 Tax=Escherichia coli R...   135    3e-29 
  UniRef100_T1AB13 Osmolarity sensory histidine kinase EnvZ (Frag...   135    3e-29 
  UniRef100_K3KS25 Sensor protein RstB n=1 Tax=Escherichia coli N...   135    3e-29 
  UniRef100_B1LES7 Sensor histidine kinase RstB n=3 Tax=Escherich...   135    3e-29 
  UniRef100_R9PGZ9 Integral membrane sensor signal transduction h...   135    3e-29 
  UniRef100_UPI00037447ED hypothetical protein n=1 Tax=Methylobac...   135    3e-29 
  UniRef100_F0LPS4 Signal transduction histidine kinase n=2 Tax=V...   135    3e-29 
  UniRef100_Q7ADM2 Sensor histidine protein kinase RstA regulator...   135    3e-29 
  UniRef100_W1J3Q7 Sensory histidine kinase in two-component regu...   135    4e-29 
  UniRef100_N8ZL69 Uncharacterized protein n=2 Tax=Acinetobacter ...   135    4e-29 
  UniRef100_L4JMX0 Sensor protein rstB n=3 Tax=Escherichia coli R...   135    4e-29 
  UniRef100_F7SAK5 Signal transduction histidine kinase n=1 Tax=A...   135    4e-29 
  UniRef100_Q66AA1 Two-component regulatory system, sensor kinase...   135    4e-29 
  UniRef100_W0KXX9 Sensory histidine kinase in two-component regu...   135    4e-29 
  UniRef100_I4SED5 Sensor protein RstB n=3 Tax=Escherichia coli R...   135    4e-29 
  UniRef100_F4U9M4 Sensor protein RstB n=1 Tax=Escherichia coli T...   135    4e-29 
  UniRef100_X6H848 ATPase n=1 Tax=Mesorhizobium sp. L2C084A000 Re...   135    4e-29 
  UniRef100_L9PKN9 Signal transduction histidine kinase n=1 Tax=J...   135    4e-29 
  UniRef100_A9D5A1 Periplasmic sensor signal transduction histidi...   135    4e-29 
  UniRef100_A0A017K018 Sensor protein rstB n=13 Tax=Escherichia c...   135    4e-29 
  UniRef100_UPI0003770C7C ATPase n=1 Tax=Methylosinus sp. LW4 Rep...   135    4e-29 
  UniRef100_UPI0003EF1E49 sensor protein RstB n=1 Tax=Shigella so...   135    4e-29 
  UniRef100_UPI0003729E79 histidine kinase n=1 Tax=Halomonas zhan...   135    4e-29 
  UniRef100_K8RLD0 Integral membrane sensor signal transduction h...   135    4e-29 
  UniRef100_F3WHX8 Sensor protein rstB n=1 Tax=Shigella boydii 52...   135    4e-29 
  UniRef100_C3T957 Sensor histidine protein kinase RstA regulator...   135    4e-29 
  UniRef100_UPI0003086271 hypothetical protein n=1 Tax=Limnohabit...   135    4e-29 
  UniRef100_UPI000287B794 histidine kinase n=1 Tax=Halomonas sp. ...   135    4e-29 
  UniRef100_D0KDF9 Integral membrane sensor signal transduction h...   135    4e-29 
  UniRef100_A3RNS3 Osmolarity sensor protein envZ n=1 Tax=Ralston...   135    4e-29 
  UniRef100_UPI0003EF2204 sensor protein RstB n=1 Tax=Escherichia...   135    4e-29 
  UniRef100_U1GP83 Uncharacterized protein n=1 Tax=Gallibacterium...   135    4e-29 
  UniRef100_T9SSZ6 Sensor protein rstB n=1 Tax=Escherichia coli U...   135    4e-29 
  UniRef100_Q4UYM6 Two-component system sensor protein n=2 Tax=Xa...   135    4e-29 
  UniRef100_D2TC23 Two-component sensor kinase n=3 Tax=Erwinia Re...   135    4e-29 
  UniRef100_UPI000348764C sensor histidine kinase n=1 Tax=Burkhol...   135    4e-29 
  UniRef100_S5UEW4 Two-component sensor protein n=2 Tax=Proteus m...   135    4e-29 
  UniRef100_Q7MMI0 Signal transduction histidine kinase n=1 Tax=V...   135    4e-29 
  UniRef100_W2TY90 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   135    4e-29 
  UniRef100_A4YN29 Putative two-component sensor histidine kinase...   135    4e-29 
  UniRef100_F3S9F6 Osmolarity sensor protein envZ n=1 Tax=Glucona...   135    4e-29 
  UniRef100_C9QLS3 Signal transduction histidine kinase n=1 Tax=V...   135    4e-29 
  UniRef100_UPI00036A978A ATPase n=1 Tax=Agrobacterium sp. 224MFT...   135    4e-29 
  UniRef100_L4P2F9 Sensor protein rstB n=1 Tax=Escherichia coli K...   135    4e-29 
  UniRef100_K1JSZ2 Uncharacterized protein n=1 Tax=Aeromonas vero...   135    4e-29 
  UniRef100_Q5FUN2 Osmolarity sensor protein envZ n=1 Tax=Glucono...   135    4e-29 
  UniRef100_B6R4A0 Osmolarity sensor protein EnvZ n=1 Tax=Pseudov...   135    4e-29 
  UniRef100_UPI0003B65CE9 histidine kinase n=1 Tax=Sphingomonas-l...   135    4e-29 
  UniRef100_N8FQV0 Uncharacterized protein n=1 Tax=Brucella sp. 6...   135    4e-29 
  UniRef100_I0VM77 Sensor protein RstB n=4 Tax=Escherichia coli R...   135    4e-29 
  UniRef100_B2IFH9 Integral membrane sensor signal transduction h...   135    4e-29 
  UniRef100_A7ZM69 Sensor histidine kinase RstB n=1 Tax=Escherich...   135    4e-29 
  UniRef100_K1J2U0 Uncharacterized protein n=1 Tax=Aeromonas vero...   135    4e-29 
  UniRef100_I0HSP1 Osmolarity sensor protein OmpB n=1 Tax=Rubrivi...   135    5e-29 
  UniRef100_I6DHT7 Sensor protein rstB n=1 Tax=Shigella boydii 96...   135    5e-29 
  UniRef100_UPI00036F7B3F hypothetical protein n=1 Tax=gamma prot...   135    5e-29 
  UniRef100_UPI00036577A3 hypothetical protein n=1 Tax=gamma prot...   135    5e-29 
  UniRef100_W6RCI0 Two-component system, OmpR family, osmolarity ...   135    5e-29 
  UniRef100_C6C5G7 Histidine kinase n=1 Tax=Dickeya dadantii (str...   135    5e-29 
  UniRef100_J2GTD1 Signal transduction histidine kinase n=1 Tax=C...   135    5e-29 
  UniRef100_F9SXH5 Signal transduction histidine kinase n=1 Tax=V...   135    5e-29 
  UniRef100_N6W337 Signal transduction histidine kinase n=1 Tax=M...   135    5e-29 
  UniRef100_G4F5J6 Periplasmic sensor signal transduction histidi...   135    5e-29 
  UniRef100_P18392 Sensor protein RstB n=118 Tax=Escherichia RepI...   135    5e-29 
  UniRef100_D6JA21 Putative uncharacterized protein n=1 Tax=Esche...   135    5e-29 
  UniRef100_B3WXW1 Sensor histidine kinase RstB n=2 Tax=Shigella ...   135    5e-29 
  UniRef100_UPI00026CCA8B histidine kinase n=1 Tax=Sphingomonas s...   135    5e-29 
  UniRef100_U0BW59 Sensor protein rstB n=1 Tax=Escherichia coli K...   135    5e-29 
  UniRef100_G2H815 HAMP domain protein n=1 Tax=Desulfovibrio sp. ...   135    5e-29 
  UniRef100_D5QJ34 Integral membrane sensor signal transduction h...   135    5e-29 
  UniRef100_N4EZF0 Sensor protein rstB n=1 Tax=Escherichia coli P...   135    5e-29 
  UniRef100_N2NF12 Sensor protein rstB n=2 Tax=Escherichia coli R...   135    5e-29 
  UniRef100_N0G1A6 Two-component sensor kinase n=1 Tax=Erwinia am...   135    5e-29 
  UniRef100_J2D0W6 Signal transduction histidine kinase n=1 Tax=S...   135    5e-29 
  UniRef100_T5XK74 Sensor protein rstB n=1 Tax=Escherichia coli H...   135    5e-29 
  UniRef100_H4FDV6 Integral membrane sensor signal transduction h...   135    5e-29 
  UniRef100_F7SSZ6 Periplasmic sensor signal transduction histidi...   135    5e-29 
  UniRef100_N9MJS1 Uncharacterized protein n=1 Tax=Acinetobacter ...   135    5e-29 
  UniRef100_A0A021X1A9 Osmolarity sensor protein EnvZ n=1 Tax=Shi...   135    5e-29 
  UniRef100_V6FTB5 GHKL domain protein n=1 Tax=Escherichia coli 9...   135    5e-29 
  UniRef100_K5YX36 Integral membrane sensor signal transduction h...   135    5e-29 
  UniRef100_F0Q9E0 Integral membrane sensor signal transduction h...   135    5e-29 
  UniRef100_T0J4L4 Histidine kinase n=1 Tax=Sphingobium ummariens...   135    5e-29 
  UniRef100_N4HVA1 Sensor protein rstB n=1 Tax=Escherichia coli P...   135    5e-29 
  UniRef100_N0EHC0 Two-component sensor kinase n=1 Tax=Erwinia am...   135    5e-29 
  UniRef100_J7R172 Sensor histidine protein kinase (RstA regulato...   135    5e-29 
  UniRef100_T6UIK8 Sensor protein rstB n=2 Tax=Escherichia coli R...   135    5e-29 
  UniRef100_E5B0B5 Two-component sensor kinase n=1 Tax=Erwinia am...   135    5e-29 
  UniRef100_E7T368 Sensory histidine kinase in two-component regu...   135    6e-29 
  UniRef100_U4M3R3 Putative two-component system sensor protein n...   135    6e-29 
  UniRef100_N4LJI3 Sensor protein rstB n=1 Tax=Escherichia coli p...   135    6e-29 
  UniRef100_G6XFN5 Two component sensor histidine kinase n=1 Tax=...   134    6e-29 
  UniRef100_V8G7X9 Histidine kinase n=1 Tax=Pelistega sp. HM-7 Re...   134    6e-29 
  UniRef100_UPI000364B29C sensor protein RstB n=1 Tax=Escherichia...   134    6e-29 
  UniRef100_A9MBB7 Two-component sensor histidine kinase n=15 Tax...   134    6e-29 
  UniRef100_G8NM97 Osmolarity sensor protein EnvZ, putative n=7 T...   134    6e-29 
  UniRef100_F7R982 HAMP domain protein n=1 Tax=Shigella flexneri ...   134    6e-29 
  UniRef100_M9LIJ7 Sensor protein rstB n=1 Tax=Escherichia coli 2...   134    6e-29 
  UniRef100_M9C6B7 Sensor protein rstB n=1 Tax=Escherichia coli 2...   134    6e-29 
  UniRef100_M8Z903 Sensor protein rstB n=2 Tax=Escherichia coli R...   134    6e-29 
  UniRef100_U2LRJ9 Copper sensory histidine kinase CpxA n=1 Tax=P...   134    6e-29 
  UniRef100_L4BZ97 Sensor protein rstB n=1 Tax=Escherichia coli K...   134    6e-29 
  UniRef100_D0PFI3 Two-component sensor histidine kinase n=1 Tax=...   134    6e-29 
  UniRef100_N7UCT4 Uncharacterized protein n=3 Tax=Brucella abort...   134    6e-29 
  UniRef100_U3TZG2 Integral membrane sensor signal transduction h...   134    6e-29 
  UniRef100_B7KPR0 Histidine kinase n=1 Tax=Methylobacterium exto...   134    6e-29 
  UniRef100_U1TN60 Histidine kinase n=1 Tax=Pantoea dispersa EGD-...   134    6e-29 
  UniRef100_N7N917 Uncharacterized protein n=4 Tax=Brucella melit...   134    6e-29 
  UniRef100_N4JL52 Sensor protein rstB n=1 Tax=Escherichia coli p...   134    6e-29 
  UniRef100_A9WYF3 Uncharacterized protein n=21 Tax=Brucella suis...   134    6e-29 
  UniRef100_H0RY83 Putative two component sensor histidine kinase...   134    6e-29 
  UniRef100_K1I9W6 Uncharacterized protein n=1 Tax=Aeromonas vero...   134    6e-29 
  UniRef100_UPI0002E5E2A7 histidine kinase n=1 Tax=Pseudomonas fu...   134    6e-29 
  UniRef100_L3AYG5 Sensor protein rstB n=3 Tax=Escherichia coli R...   134    6e-29 
  UniRef100_A1K957 Putative sensor histidine kinase n=1 Tax=Azoar...   134    6e-29 
  UniRef100_C9UTJ4 Two-component sensor histidine kinase n=4 Tax=...   134    6e-29 
  UniRef100_C0RL10 Two-component sensor histidine kinase n=52 Tax...   134    6e-29 
  UniRef100_C5B1J6 Putative signal transduction histidine kinase ...   134    6e-29 
  UniRef100_H5EZU0 HAMP domain protein n=7 Tax=Escherichia coli R...   134    6e-29 
  UniRef100_F9YMP4 Osmolarity sensor protein EnvZ, putative n=5 T...   134    7e-29 
  UniRef100_D8CIB0 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   134    7e-29 
  UniRef100_Q88R64 Sensor histidine kinase n=1 Tax=Pseudomonas pu...   134    7e-29 
  UniRef100_C9U1A8 Two-component sensor histidine kinase n=2 Tax=...   134    7e-29 
  UniRef100_J2PNA6 Signal transduction histidine kinase n=1 Tax=P...   134    7e-29 
  UniRef100_W9H8V1 Histidine kinase n=1 Tax=Skermanella stibiires...   134    7e-29 
  UniRef100_T9XCZ9 Sensor protein rstB n=1 Tax=Escherichia coli U...   134    7e-29 
  UniRef100_T7TXH2 Sensor protein rstB n=1 Tax=Escherichia coli H...   134    7e-29 
  UniRef100_F7U7U9 Two component sensor kinase n=1 Tax=Agrobacter...   134    7e-29 
  UniRef100_D1F440 Two-component sensor histidine kinase n=1 Tax=...   134    7e-29 
  UniRef100_E7TEG2 Sensory histidine kinase in two-component regu...   134    7e-29 
  UniRef100_V1DGH7 Integral membrane sensor signal transduction h...   134    7e-29 
  UniRef100_I5BR75 Sensor signal transduction histidine kinase n=...   134    7e-29 
  UniRef100_A1ABF4 Sensor protein RstB n=318 Tax=Escherichia RepI...   134    7e-29 
  UniRef100_UPI0002895FF0 histidine kinase n=1 Tax=Sphingomonas s...   134    7e-29 
  UniRef100_A0A014MT15 Osmolarity sensor protein EnvZ n=1 Tax=Bru...   134    7e-29 
  UniRef100_T9GX63 Sensor protein rstB n=1 Tax=Escherichia coli U...   134    7e-29 
  UniRef100_T6JUL8 Sensor protein rstB n=1 Tax=Escherichia coli H...   134    7e-29 
  UniRef100_K6YTA9 Two-component system, OmpR family, sensor kina...   134    7e-29 
  UniRef100_C6CG70 Histidine kinase n=1 Tax=Dickeya zeae (strain ...   134    7e-29 
  UniRef100_D6LSP3 ATPase-like ATP-binding protein n=1 Tax=Brucel...   134    7e-29 
  UniRef100_M9T9W4 Osmolarity sensor protein EnvZ n=1 Tax=Rickett...   134    8e-29 
  UniRef100_E2CIF6 Periplasmic sensor signal transduction histidi...   134    8e-29 
  UniRef100_J2LMY5 Signal transduction histidine kinase n=1 Tax=P...   134    8e-29 
  UniRef100_F4VVB7 Sensor protein RstB n=5 Tax=Escherichia coli R...   134    8e-29 
  UniRef100_T0HU77 Uncharacterized protein n=1 Tax=Sphingobium ba...   134    8e-29 
  UniRef100_B9JZ21 Two component sensor kinase n=1 Tax=Agrobacter...   134    8e-29 
  UniRef100_E6WAH3 Integral membrane sensor signal transduction h...   134    8e-29 
  UniRef100_D9QFN2 Integral membrane sensor signal transduction h...   134    8e-29 
  UniRef100_E1IK99 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   134    8e-29 
  UniRef100_UPI0003EF6279 sensor protein RstB n=1 Tax=Escherichia...   134    8e-29 
  UniRef100_I2WTJ8 GHKL domain protein n=1 Tax=Escherichia coli 4...   134    8e-29 
  UniRef100_N8NTT6 Uncharacterized protein n=1 Tax=Acinetobacter ...   134    8e-29 
  UniRef100_B6VLZ8 Two-component sensor kinase n=1 Tax=Photorhabd...   134    9e-29 
  UniRef100_B7NB62 Sensory histidine kinase in two-component regu...   134    9e-29 
  UniRef100_U9KTI1 Two-component system sensor n=1 Tax=Pseudomona...   134    9e-29 
  UniRef100_C8U8T0 Sensory histidine kinase RstB in two-component...   134    9e-29 
  UniRef100_J2GUH6 Signal transduction histidine kinase n=1 Tax=N...   134    9e-29 
  UniRef100_H1BXY3 Sensor protein rstB n=1 Tax=Escherichia coli 4...   134    9e-29 
  UniRef100_N3RV10 Sensor protein rstB n=1 Tax=Escherichia coli P...   134    9e-29 
  UniRef100_H5GCK2 HAMP domain protein n=1 Tax=Escherichia coli D...   134    9e-29 
  UniRef100_D5AX16 Osmolarity sensor protein EnvZ n=11 Tax=Ricket...   134    9e-29 
  UniRef100_UPI000367692E hypothetical protein, partial n=1 Tax=X...   134    9e-29 
  UniRef100_H0PZ03 Histidine kinase-like ATPase n=1 Tax=Azoarcus ...   134    9e-29 
  UniRef100_T7FV21 Sensor protein rstB n=1 Tax=Escherichia coli H...   134    9e-29 
  UniRef100_K2LU43 Two-component sensor histidine kinase n=1 Tax=...   134    9e-29 
  UniRef100_F4DH70 Signal transduction histidine kinase n=2 Tax=A...   134    9e-29 
  UniRef100_UPI000318137A histidine kinase n=1 Tax=Acinetobacter ...   134    9e-29 
  UniRef100_F7XVS1 Signal transduction histidine kinase n=1 Tax=M...   134    9e-29 
  UniRef100_N8QLS5 Uncharacterized protein n=1 Tax=Acinetobacter ...   134    9e-29 
  UniRef100_J3HBW6 Signal transduction histidine kinase n=1 Tax=P...   134    9e-29 
  UniRef100_B7L5G1 Sensory histidine kinase in two-component regu...   134    9e-29 
  UniRef100_Q3BXJ9 Two-component system regulatory protein, EnvZ ...   134    9e-29 
  UniRef100_F2PDJ7 HAMP domain protein n=1 Tax=Photobacterium lei...   134    9e-29 
  UniRef100_UPI00031A9EF7 histidine kinase n=1 Tax=Xanthomonas ax...   134    9e-29 
  UniRef100_L1LSG9 Periplasmic sensor signal transduction histidi...   134    9e-29 
  UniRef100_D0SBA6 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   134    1e-28 
  UniRef100_UPI0003754C74 histidine kinase n=1 Tax=Bradyrhizobium...   134    1e-28 
  UniRef100_V6WQC2 Sensory histidine kinase in two-component regu...   134    1e-28 
  UniRef100_N2HF79 Sensor protein rstB n=1 Tax=Escherichia coli P...   134    1e-28 
  UniRef100_M8QIJ7 Sensor protein rstB n=1 Tax=Escherichia coli M...   134    1e-28 
  UniRef100_L3YCA7 Sensor protein rstB n=2 Tax=Escherichia coli R...   134    1e-28 
  UniRef100_Q83KZ3 Sensor histidine protein kinase, RstA regulato...   134    1e-28 
  UniRef100_UPI00031340E9 histidine kinase n=1 Tax=Xanthomonas ax...   134    1e-28 
  UniRef100_W6I5S7 Osmolarity sensor protein envZ n=1 Tax=Granuli...   134    1e-28 
  UniRef100_UPI0002B962BD sensor protein RstB n=1 Tax=Escherichia...   134    1e-28 
  UniRef100_Q0BPW2 Osmolarity sensor protein envZ n=1 Tax=Granuli...   134    1e-28 
  UniRef100_UPI0003EF77C4 sensor protein RstB n=1 Tax=Escherichia...   134    1e-28 
  UniRef100_M8MN45 Sensor protein rstB n=4 Tax=Escherichia coli R...   134    1e-28 
  UniRef100_F0BWE3 Signal transduction histidine kinase n=9 Tax=X...   134    1e-28 
  UniRef100_R9VLC0 Sensor protein RstB n=1 Tax=Enterobacter sp. R...   134    1e-28 
  UniRef100_U5VJC1 Integral membrane sensor signal transduction h...   134    1e-28 
  UniRef100_W6IJD8 Osmolarity sensor protein envZ n=1 Tax=Granuli...   134    1e-28 
  UniRef100_B1KG97 Integral membrane sensor signal transduction h...   134    1e-28 
  UniRef100_W6IP64 Osmolarity sensor protein envZ n=1 Tax=Granuli...   134    1e-28 
  UniRef100_A9CI63 Two component sensor kinase n=1 Tax=Agrobacter...   134    1e-28 
  UniRef100_M3KGU5 Integral membrane sensor signal transduction h...   134    1e-28 
  UniRef100_K5IEV1 Sensor histidine protein kinase n=1 Tax=Escher...   134    1e-28 
  UniRef100_UPI000371B6D6 hypothetical protein n=1 Tax=Janthinoba...   134    1e-28 
  UniRef100_I6X0X4 Sensor kinase n=3 Tax=Taylorella equigenitalis...   134    1e-28 
  UniRef100_UPI00034B5186 histidine kinase n=1 Tax=Pseudomonas sp...   134    1e-28 
  UniRef100_B2VL56 Sensory kinase in two-component regulatory sys...   134    1e-28 
  UniRef100_L1M330 Sensory histidine kinase n=1 Tax=Pseudomonas p...   134    1e-28 
  UniRef100_V5Z3B3 Two-component sensor kinase n=1 Tax=Erwinia pi...   134    1e-28 
  UniRef100_J2IMS9 Signal transduction histidine kinase n=1 Tax=R...   134    1e-28 
  UniRef100_H4JLW0 HAMP domain protein n=1 Tax=Escherichia coli D...   134    1e-28 
  UniRef100_UPI000361A81E histidine kinase n=1 Tax=alpha proteoba...   134    1e-28 
  UniRef100_V0A6E3 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   134    1e-28 
  UniRef100_D7YS09 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   134    1e-28 
  UniRef100_UPI0002DC620B histidine kinase n=1 Tax=Herbaspirillum...   134    1e-28 
  UniRef100_UPI000237F29A histidine kinase n=1 Tax=Komagataeibact...   134    1e-28 
  UniRef100_U1BX26 Integral membrane sensor signal transduction h...   134    1e-28 
  UniRef100_K3JQJ2 Hsp90-like protein n=2 Tax=Escherichia coli Re...   134    1e-28 
  UniRef100_A4TIX8 Two-component regulatory system, sensor kinase...   134    1e-28 
  UniRef100_Q5FQK6 Two component sensor histidine kinase n=1 Tax=...   134    1e-28 
  UniRef100_X6DHN2 ATPase n=1 Tax=Mesorhizobium sp. LNHC221B00 Re...   134    1e-28 
  UniRef100_UPI00031F0530 histidine kinase n=1 Tax=Komagataeibact...   133    1e-28 
  UniRef100_W5YCE2 Integral membrane sensor signal transduction h...   133    1e-28 
  UniRef100_Q46W01 ATP-binding region, ATPase-like:Histidine kina...   133    1e-28 
  UniRef100_L3UIM3 Sensor protein rstB n=1 Tax=Escherichia coli K...   133    1e-28 
  UniRef100_F5JJK0 Two component sensor kinase n=1 Tax=Agrobacter...   133    1e-28 
  UniRef100_W6J7H8 Two-component sensor protein n=1 Tax=Enterobac...   133    1e-28 
  UniRef100_W8T9Y2 Sensor protein RstB n=44 Tax=Enterobacteriacea...   133    1e-28 
  UniRef100_K2P8N1 Sensor signal transduction histidine kinase n=...   133    1e-28 
  UniRef100_G9Y1P7 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   133    1e-28 
  UniRef100_R9VSW3 Histidine kinase n=1 Tax=Enterobacter sp. R4-3...   133    1e-28 
  UniRef100_U7FE91 Sensor protein RstB n=1 Tax=Yersinia pestis 9 ...   133    1e-28 
  UniRef100_E9YNE9 Hsp90-like protein n=3 Tax=Escherichia coli Re...   133    1e-28 
  UniRef100_A3JPB2 Signal transduction kinase protein n=1 Tax=Rho...   133    1e-28 
  UniRef100_K4XMI4 Sensor protein RstB n=1 Tax=Escherichia coli O...   133    1e-28 
  UniRef100_H7ERL7 Sensor histidine kinase n=1 Tax=Pseudomonas st...   133    1e-28 
  UniRef100_A7FHS2 Sensor protein RstB n=6 Tax=Yersinia RepID=A7F...   133    1e-28 
  UniRef100_A2C9J2 Two-component sensor histidine kinase n=1 Tax=...   133    1e-28 
  UniRef100_H1DXP6 Sensor protein rstB n=1 Tax=Escherichia coli B...   133    1e-28 
  UniRef100_UPI00037A7283 sensor histidine kinase n=1 Tax=Oxaloba...   133    1e-28 
  UniRef100_V2QLS5 Sensor protein rstB n=1 Tax=Escherichia coli U...   133    1e-28 
  UniRef100_J1YXR5 Sensor protein CpxA n=1 Tax=Kosakonia radicinc...   133    1e-28 
  UniRef100_F2K037 Integral membrane sensor signal transduction h...   133    1e-28 
  UniRef100_N8SFC8 Uncharacterized protein n=1 Tax=Acinetobacter ...   133    1e-28 
  UniRef100_H0TP56 Putative two component sensor histidine kinase...   133    1e-28 
  UniRef100_UPI00038203B1 histidine kinase n=1 Tax=Acinetobacter ...   133    1e-28 
  UniRef100_V2RC14 Uncharacterized protein n=1 Tax=Acinetobacter ...   133    1e-28 
  UniRef100_N2CQ26 Uncharacterized protein n=5 Tax=Pseudomonas ae...   133    1e-28 
  UniRef100_H2FYB0 Two-component system sensor histidine kinase n...   133    2e-28 
  UniRef100_E9XJT0 Hsp90-like protein n=1 Tax=Escherichia coli TW...   133    2e-28 
  UniRef100_W1J2M6 Sensory histidine kinase in two-component regu...   133    2e-28 
  UniRef100_J2LBV9 Signal transduction histidine kinase n=1 Tax=H...   133    2e-28 
  UniRef100_D0JBV5 Two-component regulatory system, sensor kinase...   133    2e-28 
  UniRef100_D7HWN4 Signal transduction histidine kinase n=1 Tax=P...   133    2e-28 
  UniRef100_W1G821 Sensory histidine kinase in two-component regu...   133    2e-28 
  UniRef100_J2FXT4 HAMP domain protein n=2 Tax=Shigella flexneri ...   133    2e-28 
  UniRef100_UPI00034BABD7 ATPase n=1 Tax=Methylobacterium sp. MB2...   133    2e-28 
  UniRef100_N8BXF0 Uncharacterized protein n=1 Tax=Brucella melit...   133    2e-28 
  UniRef100_UPI00038030B8 hypothetical protein, partial n=1 Tax=P...   133    2e-28 
  UniRef100_A0A017JRB4 Sensor protein rstB n=9 Tax=Escherichia co...   133    2e-28 
  UniRef100_UPI000262434A histidine kinase n=1 Tax=Acinetobacter ...   133    2e-28 
  UniRef100_Q6CZ41 Two-component sensor kinase n=1 Tax=Pectobacte...   133    2e-28 
  UniRef100_D6IAS1 Two-component system n=1 Tax=Escherichia coli ...   133    2e-28 
  UniRef100_UPI000345C3BE ATPase n=1 Tax=Methylobacterium sp. MB2...   133    2e-28 
  UniRef100_A9VXH5 ATP-binding region ATPase domain protein n=1 T...   133    2e-28 
  UniRef100_M9E1F6 Sensor protein rstB n=1 Tax=Escherichia coli 2...   133    2e-28 
  UniRef100_M8RRY3 Sensor protein rstB n=5 Tax=Escherichia coli R...   133    2e-28 
  UniRef100_UPI000289DA26 histidine kinase n=1 Tax=Sphingomonas s...   133    2e-28 
  UniRef100_UPI0003464B44 hypothetical protein n=1 Tax=Pandoraea ...   133    2e-28 
  UniRef100_K2AIV6 Sensor protein n=1 Tax=uncultured bacterium Re...   133    2e-28 
  UniRef100_I0VD65 Sensor protein RstB n=8 Tax=Shigella flexneri ...   133    2e-28 
  UniRef100_V5E700 Sensor protein CpxA n=1 Tax=Serratia sp. DD3 R...   133    2e-28 
  UniRef100_J7UEZ7 Integral membrane sensor signal transduction h...   133    2e-28 
  UniRef100_C4UDK6 Putative uncharacterized protein n=1 Tax=Yersi...   133    2e-28 
  UniRef100_A0A022HL25 Sensor protein rstB n=5 Tax=Klebsiella oxy...   133    2e-28 
  UniRef100_UPI0003C1AB8E PREDICTED: uncharacterized protein LOC1...   133    2e-28 
  UniRef100_X6F2P9 ATPase n=1 Tax=Mesorhizobium sp. LNHC229A00 Re...   133    2e-28 
  UniRef100_Q0T4G7 Sensor histidine protein kinase n=1 Tax=Shigel...   133    2e-28 
  UniRef100_D6CQ24 Putative Osmolarity sensor protein envZ n=1 Ta...   133    2e-28 
  UniRef100_N2Z6E1 Sensor protein rstB n=1 Tax=Escherichia coli P...   133    2e-28 
  UniRef100_M8R0Z1 Sensor protein rstB n=1 Tax=Escherichia coli B...   133    2e-28 
  UniRef100_U1HDG0 Sensor histidine kinase n=1 Tax=Aeromonas vero...   133    2e-28 
  UniRef100_U7C5C1 Sensor protein rstB n=15 Tax=Escherichia coli ...   133    2e-28 
  UniRef100_UPI0002F12E32 sensor histidine kinase n=1 Tax=Pseudom...   133    2e-28 
  UniRef100_X6EGX5 ATPase n=2 Tax=Mesorhizobium RepID=X6EGX5_9RHIZ     133    2e-28 
  UniRef100_N2ZZ74 Sensor protein rstB n=1 Tax=Escherichia coli P...   133    2e-28 
  UniRef100_UPI0003625527 hypothetical protein n=1 Tax=Endozoicom...   133    2e-28 
  UniRef100_F2ZK62 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   133    2e-28 
  UniRef100_E9TDH9 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   133    2e-28 
  UniRef100_F0Q4P7 Integral membrane sensor signal transduction h...   133    2e-28 
  UniRef100_F4UPS2 Sensor protein RstB n=1 Tax=Escherichia coli T...   133    2e-28 
  UniRef100_H0J7I7 Sensor histidine kinase n=1 Tax=Pseudomonas ps...   133    2e-28 
  UniRef100_M8PW98 Sensor protein rstB n=7 Tax=Escherichia coli R...   133    2e-28 
  UniRef100_UPI0003EF6100 sensor protein RstB n=1 Tax=Escherichia...   133    2e-28 
  UniRef100_UPI00031D6DDB histidine kinase n=1 Tax=Acidovorax ave...   133    2e-28 
  UniRef100_A3SGJ7 Sensor histidine kinase n=1 Tax=Sulfitobacter ...   133    2e-28 
  UniRef100_V5Z7S5 Two component sensor kinase n=1 Tax=Erwinia pi...   133    2e-28 
  UniRef100_K6APC9 Sensor histidine kinase n=1 Tax=Pseudomonas vi...   133    2e-28 
  UniRef100_E0DV42 Two-component sensor histidine kinase n=1 Tax=...   133    2e-28 
  UniRef100_W0H110 Sensor histidine kinase n=1 Tax=Pseudomonas ci...   133    2e-28 
  UniRef100_F5XVQ5 Candidate histidine kinase, classic n=1 Tax=Ra...   133    2e-28 
  UniRef100_D4GE00 CpxA n=5 Tax=Pantoea ananas RepID=D4GE00_PANAM      133    2e-28 
  UniRef100_UPI00036E0C0A hypothetical protein n=1 Tax=Halomonas ...   133    2e-28 
  UniRef100_UPI00037052AE sensor histidine kinase n=1 Tax=Pseudom...   132    2e-28 
  UniRef100_UPI0002F41C8A histidine kinase n=1 Tax=Komagataeibact...   132    2e-28 
  UniRef100_UPI00031E4088 sensor protein RstB n=1 Tax=Enterobacte...   132    2e-28 
  UniRef100_B8KA42 Signal transduction histidine kinase n=1 Tax=V...   132    2e-28 
  UniRef100_V4XAW2 Sensor histidine kinase n=2 Tax=Pseudomonas ae...   132    2e-28 
  UniRef100_N8Q9W9 Uncharacterized protein n=6 Tax=Acinetobacter ...   132    2e-28 
  UniRef100_UPI0002FF4D92 histidine kinase n=1 Tax=Pseudomonas mo...   132    2e-28 
  UniRef100_D8IVP2 Two component sensor histidine kinase protein ...   132    2e-28 
  UniRef100_K2LHP6 Sensor signal transduction histidine kinase n=...   132    2e-28 
  UniRef100_Q6N3X1 Two component sensor histidine kinase n=1 Tax=...   132    2e-28 
  UniRef100_D1D1J6 Two-component sensor histidine kinase n=1 Tax=...   132    2e-28 
  UniRef100_UPI0003A1D4D4 ATPase n=1 Tax=Pseudochrobactrum sp. AO...   132    2e-28 
  UniRef100_N9F9Z2 Uncharacterized protein n=1 Tax=Acinetobacter ...   132    2e-28 
  UniRef100_UPI000370B9A5 sensor protein RstB n=1 Tax=Escherichia...   132    2e-28 
  UniRef100_UPI00036336A2 hypothetical protein n=1 Tax=Henriciell...   132    2e-28 
  UniRef100_N8RGE5 Uncharacterized protein n=1 Tax=Acinetobacter ...   132    2e-28 
  UniRef100_UPI00029A4D45 histidine kinase n=1 Tax=Acinetobacter ...   132    2e-28 
  UniRef100_A1TMI4 Integral membrane sensor signal transduction h...   132    2e-28 
  UniRef100_Y1GZQ5 Sensor protein rstB n=1 Tax=Enterobacter sp. B...   132    2e-28 
  UniRef100_U3HAJ4 Uncharacterized protein n=1 Tax=Pseudomonas al...   132    2e-28 
  UniRef100_D5CAU1 Sensor protein RstB n=1 Tax=Enterobacter cloac...   132    2e-28 
  UniRef100_H3RIF2 Sensory histidine kinase in two-component regu...   132    2e-28 
  UniRef100_UPI00036DAB51 sensor histidine kinase n=1 Tax=Psychro...   132    2e-28 
  UniRef100_U9YPQ0 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   132    2e-28 
  UniRef100_V2Z3K4 Sensor protein rstB n=1 Tax=Escherichia coli B...   132    2e-28 
  UniRef100_N2JM77 Uncharacterized protein n=1 Tax=Pseudomonas sp...   132    2e-28 
  UniRef100_G8T5B1 ATPase-like ATP-binding protein n=111 Tax=Bruc...   132    2e-28 
  UniRef100_UPI0003EFACA1 sensor protein RstB n=1 Tax=Escherichia...   132    3e-28 
  UniRef100_A1SX11 Sensor histidine kinase with ATPase domain n=1...   132    3e-28 
  UniRef100_X6CG42 ATPase n=1 Tax=Mesorhizobium sp. LNHC232B00 Re...   132    3e-28 
  UniRef100_L2VWR4 Sensor protein rstB n=3 Tax=Escherichia coli R...   132    3e-28 
  UniRef100_N9H0R0 Uncharacterized protein n=2 Tax=Acinetobacter ...   132    3e-28 
  UniRef100_UPI000376DFF6 sensor protein RstB n=1 Tax=Escherichia...   132    3e-28 
  UniRef100_V3TME3 Uncharacterized protein n=1 Tax=Serratia sp. A...   132    3e-28 
  UniRef100_N3JIG3 Sensor protein rstB n=1 Tax=Escherichia coli 2...   132    3e-28 
  UniRef100_U8MCK8 Two-component system sensor n=1 Tax=Pseudomona...   132    3e-28 
  UniRef100_B8CHU2 ATP-binding region, ATPase-like:Histidine kina...   132    3e-28 
  UniRef100_Q2C8F5 Putative Signal transduction histidine kinase ...   132    3e-28 
  UniRef100_C9UA48 Two-component sensor histidine kinase n=3 Tax=...   132    3e-28 
  UniRef100_V5T1H4 Sensor histidine kinase n=18 Tax=Pseudomonas R...   132    3e-28 
  UniRef100_Q8PPF7 Two-component system sensor protein n=1 Tax=Xa...   132    3e-28 
  UniRef100_Z4WIQ4 Two-component system sensor protein n=1 Tax=Xa...   132    3e-28 
  UniRef100_U1FRZ0 Histidine kinase n=1 Tax=Aeromonas veronii Hm2...   132    3e-28 
  UniRef100_UPI000362CBCE hypothetical protein n=1 Tax=Bradyrhizo...   132    3e-28 
  UniRef100_U8APL8 Two-component system sensor n=3 Tax=Pseudomona...   132    3e-28 
  UniRef100_T0FYW5 Histidine kinase n=1 Tax=Sphingobium baderi LL...   132    3e-28 
  UniRef100_UPI00037C3E01 hypothetical protein n=1 Tax=beta prote...   132    3e-28 
  UniRef100_H5WK37 Signal transduction histidine kinase n=1 Tax=B...   132    3e-28 
  UniRef100_N8P291 Uncharacterized protein n=1 Tax=Acinetobacter ...   132    3e-28 
  UniRef100_E5YN14 Sensor protein CpxA n=2 Tax=Enterobacteriaceae...   132    3e-28 
  UniRef100_UPI000305C50D histidine kinase n=1 Tax=Acinetobacter ...   132    3e-28 
  UniRef100_F4DGI4 Sensor histidine kinase n=2 Tax=Aeromonas vero...   132    3e-28 
  UniRef100_L2XNV8 Sensor protein rstB n=7 Tax=Escherichia coli R...   132    3e-28 
  UniRef100_G6XZR9 Two-component sensor histidine kinase protein ...   132    3e-28 
  UniRef100_UPI0003712CE5 ATPase n=1 Tax=Variovorax paradoxus Rep...   132    3e-28 
  UniRef100_G4LRC5 Two-component sensor n=76 Tax=Pseudomonas aeru...   132    3e-28 
  UniRef100_D0SXA4 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   132    3e-28 
  UniRef100_K7T8W0 Two component sensor histidine kinase n=1 Tax=...   132    3e-28 
  UniRef100_N9LRK9 Uncharacterized protein n=1 Tax=Acinetobacter ...   132    3e-28 
  UniRef100_UPI000363F19C hypothetical protein n=1 Tax=Methylobac...   132    3e-28 
  UniRef100_B2VKM7 Two-component regulatory system, sensor kinase...   132    3e-28 
  UniRef100_C0VML6 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   132    3e-28 
  UniRef100_U8JDA3 Two-component system sensor n=3 Tax=Pseudomona...   132    3e-28 
  UniRef100_UPI0003752E82 hypothetical protein n=1 Tax=Pseudomona...   132    3e-28 
  UniRef100_K1K0N7 Uncharacterized protein n=1 Tax=Aeromonas vero...   132    3e-28 
  UniRef100_UPI00037D7C59 hypothetical protein n=1 Tax=Methylofer...   132    3e-28 
  UniRef100_E6QQD6 Putative two-component sensor histidine kinase...   132    3e-28 
  UniRef100_M4W743 Signal transduction histidine kinase n=1 Tax=X...   132    3e-28 
  UniRef100_U9SCN0 Two-component system sensor n=1 Tax=Pseudomona...   132    3e-28 
  UniRef100_F1Z8W9 Periplasmic sensor signal transduction histidi...   132    3e-28 
  UniRef100_UPI0003A94CB7 histidine kinase n=1 Tax=Dickeya dianth...   132    3e-28 
  UniRef100_R9ZCJ6 Sensor histidine kinase n=25 Tax=Pseudomonas R...   132    3e-28 
  UniRef100_V7ZFD7 Two-component system regulatory protein, EnvZ ...   132    3e-28 
  UniRef100_W8FJU8 Two component sensor histidine kinase n=1 Tax=...   132    3e-28 
  UniRef100_U8XYU5 Two-component system sensor n=2 Tax=Pseudomona...   132    3e-28 
  UniRef100_U8CHA7 Two-component system sensor n=1 Tax=Pseudomona...   132    3e-28 
  UniRef100_UPI00037F5CD4 hypothetical protein n=1 Tax=Hyphomicro...   132    3e-28 
  UniRef100_Q320W5 Sensor histidine protein kinase n=1 Tax=Shigel...   132    3e-28 
  UniRef100_N3ATM5 Sensor protein rstB n=1 Tax=Escherichia coli P...   132    3e-28 
  UniRef100_M3BW35 Two-component sensor n=2 Tax=Pseudomonas aerug...   132    3e-28 
  UniRef100_Q48MC5 Sensor histidine kinase n=6 Tax=Pseudomonas sy...   132    3e-28 
  UniRef100_F3EYX3 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   132    3e-28 
  UniRef100_UPI0003766F48 hypothetical protein n=1 Tax=Singularim...   132    3e-28 
  UniRef100_M4TQ64 Two-component system sensor protein n=1 Tax=Xa...   132    3e-28 
  UniRef100_N9NDG5 Uncharacterized protein n=1 Tax=Acinetobacter ...   132    3e-28 
  UniRef100_M8LUA2 Sensor protein rstB n=17 Tax=Escherichia coli ...   132    3e-28 
  UniRef100_K8FXH5 Two-component system sensor protein n=1 Tax=Xa...   132    3e-28 
  UniRef100_H8FAU8 HAMP domain protein n=2 Tax=Xanthomonas RepID=...   132    3e-28 
  UniRef100_W6J154 Sensor protein RstB n=1 Tax=Enterobacter sacch...   132    4e-28 
  UniRef100_T9XLB1 Sensor protein rstB n=1 Tax=Escherichia coli U...   132    4e-28 
  UniRef100_E8LZL4 Signal transduction histidine kinase n=1 Tax=V...   132    4e-28 
  UniRef100_R0D013 Signal transduction histidine kinase n=1 Tax=C...   132    4e-28 
  UniRef100_W5V643 Sensor histidine kinase n=5 Tax=Pseudomonas ae...   132    4e-28 
  UniRef100_V7D4X2 Histidine kinase n=1 Tax=Pseudomonas taiwanens...   132    4e-28 
  UniRef100_U8AK31 Two-component system sensor n=12 Tax=Pseudomon...   132    4e-28 
  UniRef100_N9BIT2 Uncharacterized protein n=1 Tax=Acinetobacter ...   132    4e-28 
  UniRef100_H1XC56 HAMP domain protein n=1 Tax=Xanthomonas axonop...   132    4e-28 
  UniRef100_N3G8P3 Sensor protein rstB n=1 Tax=Escherichia coli P...   132    4e-28 
  UniRef100_L0FJC2 Integral membrane sensor signal transduction h...   132    4e-28 
  UniRef100_UPI0002630D45 signal protein n=1 Tax=Sphingomonas elo...   132    4e-28 
  UniRef100_M8V7F0 Sensor protein rstB n=5 Tax=Escherichia coli R...   132    4e-28 
  UniRef100_UPI0003D34107 signal transduction histidine kinase n=...   132    4e-28 
  UniRef100_E5YF84 Uncharacterized protein n=1 Tax=Enterobacteria...   132    4e-28 
  UniRef100_UPI0003A06726 histidine kinase n=1 Tax=Dickeya dianth...   132    4e-28 
  UniRef100_UPI00037A7499 histidine kinase n=1 Tax=Aeromonas sp. ...   132    4e-28 
  UniRef100_N3B2G7 Sensor protein rstB n=1 Tax=Escherichia coli P...   132    4e-28 
  UniRef100_D8P5B8 Putative sensory histidine kinase in two-compo...   132    4e-28 
  UniRef100_E0SFK7 Sensory histidine kinase in two-component regu...   132    4e-28 
  UniRef100_UPI00016AA295 putative osmolarity sensor protein EnvZ...   132    4e-28 
  UniRef100_X5EHU2 Two-component sensor n=1 Tax=Pseudomonas aerug...   132    4e-28 
  UniRef100_B6ISI9 Sensor histidine kinase, putative n=1 Tax=Rhod...   132    4e-28 
  UniRef100_C4SS48 Putative uncharacterized protein n=1 Tax=Yersi...   132    4e-28 
  UniRef100_V9UG83 Histidine kinase n=2 Tax=Pseudomonas monteilii...   132    4e-28 
  UniRef100_F8FYT0 Integral membrane sensor signal transduction h...   132    4e-28 
  UniRef100_K1BI97 Two-component sensor n=1 Tax=Pseudomonas aerug...   132    4e-28 
  UniRef100_F9REQ2 Two-component sensor protein n=1 Tax=Vibrio sp...   132    4e-28 
  UniRef100_UPI0003A5DEF1 sensor protein RstB n=1 Tax=Dickeya dia...   132    4e-28 
  UniRef100_B2T1I9 Integral membrane sensor signal transduction h...   132    4e-28 
  UniRef100_S2KIM7 Uncharacterized protein n=1 Tax=Halomonas anti...   132    4e-28 
  UniRef100_H0HFD0 Integral membrane sensor signal transduction h...   132    4e-28 
  UniRef100_R9NTJ5 Sensor protein RstB n=1 Tax=Erwinia tracheiphi...   132    4e-28 
  UniRef100_M8Z1A2 Sensor protein rstB n=10 Tax=Escherichia coli ...   132    4e-28 
  UniRef100_C4UPJ9 Putative uncharacterized protein n=1 Tax=Yersi...   132    4e-28 
  UniRef100_UPI000378BD04 histidine kinase n=1 Tax=Pseudomonas me...   132    4e-28 
  UniRef100_UPI0003682CBC histidine kinase n=1 Tax=Vibrio tasmani...   132    4e-28 
  UniRef100_L0GZ34 Signal transduction histidine kinase n=1 Tax=T...   132    4e-28 
  UniRef100_M4TTV1 Two-component system sensor protein n=1 Tax=Xa...   132    4e-28 
  UniRef100_B2JHN6 Integral membrane sensor signal transduction h...   132    4e-28 
  UniRef100_G2LSB0 Two-component system sensor protein n=1 Tax=Xa...   132    4e-28 
  UniRef100_B7KZT6 Histidine kinase n=1 Tax=Methylobacterium exto...   132    4e-28 
  UniRef100_B8E5X9 Histidine kinase n=2 Tax=Shewanella baltica Re...   132    4e-28 
  UniRef100_UPI00031179E1 hypothetical protein n=1 Tax=Roseomonas...   132    4e-28 
  UniRef100_F4V2F4 Sensor protein RstB n=1 Tax=Escherichia coli T...   132    4e-28 
  UniRef100_V9WXU7 Histidine kinase n=1 Tax=Pseudomonas sp. FGI18...   132    5e-28 
  UniRef100_W8GCM8 Sensor protein RstB n=1 Tax=Yersinia similis R...   132    5e-28 
  UniRef100_Q3KCR2 Putative two-component sensor histidine kinase...   132    5e-28 
  UniRef100_G4F8D6 Integral membrane sensor signal transduction h...   132    5e-28 
  UniRef100_E1SIQ8 Probable sensor protein (Histidine protein kin...   131    5e-28 
  UniRef100_V0UGL8 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   131    5e-28 
  UniRef100_U9M6C7 Two-component system sensor n=1 Tax=Pseudomona...   131    5e-28 
  UniRef100_Q7V7E4 Two-component sensor histidine kinase n=1 Tax=...   131    5e-28 
  UniRef100_H0T5E0 Putative two-component sensor histidine kinase...   131    5e-28 
  UniRef100_N4FL36 Sensor protein CpxA n=1 Tax=Escherichia coli P...   131    5e-28 
  UniRef100_UPI0002B970AA sensor protein RstB n=1 Tax=Escherichia...   131    5e-28 
  UniRef100_Q05SJ4 Two-component sensor histidine kinase n=1 Tax=...   131    5e-28 
  UniRef100_F0LAF9 Integral membrane sensor signal transduction h...   131    5e-28 
  UniRef100_D3V6Y6 Sensory histidine kinase in two-component regu...   131    5e-28 
  UniRef100_B3QFS3 Integral membrane sensor signal transduction h...   131    5e-28 
  UniRef100_A9L287 Integral membrane sensor signal transduction h...   131    5e-28 
  UniRef100_F0C8U8 Signal transduction histidine kinase n=1 Tax=X...   131    5e-28 
  UniRef100_UPI00037DE312 hypothetical protein n=1 Tax=Chitiniphi...   131    5e-28 
  UniRef100_C9T0V7 Two component sensor histidine kinase n=4 Tax=...   131    5e-28 
  UniRef100_V5EJ58 Sensory histidine kinase in two-component regu...   131    6e-28 
  UniRef100_K1YSJ2 Sensor protein (Fragment) n=1 Tax=uncultured b...   131    6e-28 
  UniRef100_C9V610 Two-component sensor histidine kinase n=1 Tax=...   131    6e-28 
  UniRef100_B2U1R8 Sensor histidine kinase RstB n=1 Tax=Shigella ...   131    6e-28 
  UniRef100_F3S6R0 Osmolarity sensor protein envZ n=1 Tax=Glucona...   131    6e-28 
  UniRef100_W9H5L3 Uncharacterized protein n=1 Tax=Skermanella st...   131    6e-28 
  UniRef100_Q4K6Q8 Sensor histidine kinase n=2 Tax=Pseudomonas pr...   131    6e-28 
  UniRef100_Q2S9E2 Signal transduction histidine kinase n=1 Tax=H...   131    6e-28 
  UniRef100_D3P0Z6 Two-component sensor histidine kinase n=1 Tax=...   131    6e-28 
  UniRef100_D7X298 Sensor protein CpxA n=1 Tax=Escherichia coli M...   131    6e-28 
  UniRef100_A6WSA5 Integral membrane sensor signal transduction h...   131    6e-28 
  UniRef100_UPI000305D81F histidine kinase n=1 Tax=Pseudomonas fl...   131    6e-28 
  UniRef100_Q4ULR5 Osmolarity sensor protein EnvZ n=1 Tax=Rickett...   131    6e-28 
  UniRef100_J8VL56 Two component sensor histidine kinase n=1 Tax=...   131    6e-28 
  UniRef100_UPI00036A6251 histidine kinase n=1 Tax=Caulobacter sp...   131    6e-28 
  UniRef100_B7NFK9 Sensory histidine kinase in two-component regu...   131    6e-28 
  UniRef100_UPI0003719426 hypothetical protein n=1 Tax=Kaistia gr...   131    6e-28 
  UniRef100_B6ITI9 Sensor histidine kinase, putative n=1 Tax=Rhod...   131    6e-28 
  UniRef100_M9SBD9 Two-component sensor n=1 Tax=Pseudomonas aerug...   131    7e-28 
  UniRef100_UPI000361EA99 histidine kinase n=1 Tax=Caldimonas man...   131    7e-28 
  UniRef100_UPI0002E36366 sensor histidine kinase n=4 Tax=Enterov...   131    7e-28 
  UniRef100_Q4FPH6 Osmolarity sensor protein envZ n=1 Tax=Pelagib...   131    7e-28 
  UniRef100_N9BBP4 Uncharacterized protein n=2 Tax=Acinetobacter ...   131    7e-28 
  UniRef100_C4U8K9 Putative uncharacterized protein n=1 Tax=Yersi...   131    7e-28 
  UniRef100_UPI00037195FC sensor protein RstB n=1 Tax=Dickeya zea...   131    7e-28 
  UniRef100_F9S8D6 Two-component sensor protein n=1 Tax=Vibrio ic...   131    7e-28 
  UniRef100_D4I365 Two component sensor kinase n=13 Tax=Erwinia a...   131    7e-28 
  UniRef100_G6Y871 Integral membrane sensor signal transduction h...   131    7e-28 
  UniRef100_B5FPQ8 Sensor protein CpxA n=6 Tax=Salmonella dublin ...   131    7e-28 
  UniRef100_W4NE75 Signal transduction histidine kinase n=1 Tax=B...   131    7e-28 
  UniRef100_N8ZXV4 Uncharacterized protein n=3 Tax=Acinetobacter ...   131    7e-28 
  UniRef100_M3C400 Two-component sensor protein n=1 Tax=Serratia ...   131    7e-28 
  UniRef100_A0A014Q109 Sensor protein RstB n=1 Tax=Erwinia mallot...   131    7e-28 
  UniRef100_Q11GD8 Periplasmic sensor signal transduction histidi...   131    7e-28 
  UniRef100_L7ZTT6 Sensory histidine kinase in two-component regu...   131    7e-28 
  UniRef100_K8GD83 Two-component system sensor protein n=1 Tax=Xa...   131    7e-28 
  UniRef100_D0SKW6 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   131    7e-28 
  UniRef100_L0M2A9 Signal transduction histidine kinase n=1 Tax=E...   131    7e-28 
  UniRef100_N0GIU2 Two component sensor kinase n=1 Tax=Erwinia am...   131    7e-28 
  UniRef100_V3GYC9 Sensor protein rstB n=5 Tax=Enterobacter cloac...   131    7e-28 
  UniRef100_G9SJ36 Sensor protein rstB n=1 Tax=Citrobacter freund...   131    8e-28 
  UniRef100_S6B3Q3 Putative two-component sensor histidine kinase...   131    8e-28 
  UniRef100_N9ARL5 Uncharacterized protein n=2 Tax=Acinetobacter ...   131    8e-28 
  UniRef100_E6VLN5 Integral membrane sensor signal transduction h...   131    8e-28 
  UniRef100_UPI00037DF3C2 ATPase n=1 Tax=Pelagibacter ubique RepI...   130    8e-28 
  UniRef100_Q4ZXF6 ATP-binding region, ATPase-like:Histidine kina...   130    8e-28 
  UniRef100_Q1IJV5 Periplasmic sensor signal transduction histidi...   130    8e-28 
  UniRef100_U2WVU0 Ribbon-helix-helix domain protein n=1 Tax=alph...   130    8e-28 
  UniRef100_G6EXE9 Putative two component sensor histidine kinase...   130    8e-28 
  UniRef100_U4W255 Histidine kinase n=1 Tax=Pantoea agglomerans T...   130    8e-28 
  UniRef100_W0SRM8 Two-component sensor kinase n=1 Tax=Serratia m...   130    8e-28 
  UniRef100_R0FDT6 Histidine kinase n=1 Tax=Ruegeria mobilis F192...   130    8e-28 
  UniRef100_UPI00031B359C sensor histidine kinase n=1 Tax=Vibrio ...   130    9e-28 
  UniRef100_H8DIX0 Two-component sensor protein n=1 Tax=Pantoea s...   130    9e-28 
  UniRef100_E0M402 Integral membrane sensor signal transduction h...   130    9e-28 
  UniRef100_R9B646 Two-component system, OmpR family, sensor hist...   130    9e-28 
  UniRef100_F9RUB3 Two-component sensor protein n=1 Tax=Vibrio sc...   130    9e-28 
  UniRef100_D5WZV2 Integral membrane sensor signal transduction h...   130    9e-28 
  UniRef100_B8H2H4 Two-component sensor histidine kinase n=2 Tax=...   130    9e-28 
  UniRef100_A6V940 Probable two-component sensor n=1 Tax=Pseudomo...   130    9e-28 
  UniRef100_D4Z480 Two-component system osmolarity sensor histidi...   130    9e-28 
  UniRef100_V3DIP1 Sensor protein rstB n=2 Tax=Enterobacter cloac...   130    9e-28 
  UniRef100_U6ZG45 Sensor protein CpxA n=1 Tax=Dickeya sp. D s043...   130    9e-28 
  UniRef100_S0ICA6 Two-component system sensor n=3 Tax=Pseudomona...   130    9e-28 
  UniRef100_Y1K663 Sensor protein rstB n=1 Tax=Enterobacter sp. M...   130    9e-28 
  UniRef100_W9HCM5 Histidine kinase n=1 Tax=Skermanella stibiires...   130    9e-28 
  UniRef100_H1KTC7 Histidine kinase (Fragment) n=1 Tax=Methylobac...   130    9e-28 
  UniRef100_U5NAM3 Signal transduction histidine kinase n=1 Tax=C...   130    1e-27 
  UniRef100_W4HFT5 Histidine kinase n=1 Tax=Roseivivax sp. 22II-s...   130    1e-27 
  UniRef100_W6MAT2 Putative two-component sensor histidine kinase...   130    1e-27 
  UniRef100_B9K0H4 Two component sensor kinase n=1 Tax=Agrobacter...   130    1e-27 
  UniRef100_M9M8Z6 Two component sensor histidine kinase n=2 Tax=...   130    1e-27 
  UniRef100_UPI0002FB42BD histidine kinase n=1 Tax=Acinetobacter ...   130    1e-27 
  UniRef100_F7YEH6 Integral membrane sensor signal transduction h...   130    1e-27 
  UniRef100_W1N5E7 Uncharacterized protein n=1 Tax=Halomonas sp. ...   130    1e-27 
  UniRef100_W7N5X4 Sensor protein RstB n=2 Tax=Enterobacter RepID...   130    1e-27 
  UniRef100_N9FNQ1 Uncharacterized protein n=1 Tax=Acinetobacter ...   130    1e-27 
  UniRef100_G9EEY4 Sensor protein rstB n=1 Tax=Halomonas bolivien...   130    1e-27 
  UniRef100_A3T1Y6 Sensor histidine kinase n=1 Tax=Sulfitobacter ...   130    1e-27 
  UniRef100_F4DSJ5 Two component sensor histidine kinase n=1 Tax=...   130    1e-27 
  UniRef100_N9F580 Uncharacterized protein n=1 Tax=Acinetobacter ...   130    1e-27 
  UniRef100_C9NS28 Signal transduction histidine kinase n=1 Tax=V...   130    1e-27 
  UniRef100_W5Y722 Periplasmic sensor signal transduction histidi...   130    1e-27 
  UniRef100_V4QJ87 Sensor histidine kinase n=1 Tax=Pseudomonas ae...   130    1e-27 
  UniRef100_M5CUH5 Two-component system, OmpR family, sensor hist...   130    1e-27 
  UniRef100_G6YAN1 Integral membrane sensor signal transduction h...   130    1e-27 
  UniRef100_UPI00039E5F20 sensor protein RstB n=1 Tax=Enterobacte...   130    1e-27 
  UniRef100_Q11E92 Periplasmic sensor signal transduction histidi...   130    1e-27 
  UniRef100_C7CH58 Putative signal transduction histidine kinase ...   130    1e-27 
  UniRef100_N8XPJ0 Uncharacterized protein n=3 Tax=Acinetobacter ...   130    1e-27 
  UniRef100_J0W4R5 Sensor protein RstB n=1 Tax=Enterobacter sp. A...   130    1e-27 
  UniRef100_F3IUI8 Sensor histidine kinase n=2 Tax=Pseudomonas sy...   130    1e-27 
  UniRef100_Q8XQM7 Probable two component transmembrane sensor ki...   130    1e-27 
  UniRef100_B0T1F9 Integral membrane sensor signal transduction h...   130    1e-27 
  UniRef100_UPI00037DD990 MULTISPECIES: hypothetical protein n=1 ...   130    1e-27 
  UniRef100_UPI0002DE8B2D histidine kinase n=1 Tax=Pseudomonas fl...   130    1e-27 
  UniRef100_UPI0001E29B85 sensor histidine kinase n=1 Tax=Pseudom...   130    1e-27 
  UniRef100_UPI0002DB43F2 histidine kinase n=1 Tax=Halomonas stev...   130    1e-27 
  UniRef100_G0JQ55 Integral membrane sensor signal transduction h...   130    1e-27 
  UniRef100_W0IRJ6 Histidine kinase n=1 Tax=Rhizobium leguminosar...   130    1e-27 
  UniRef100_G2SBC0 Integral membrane sensor signal transduction h...   130    1e-27 
  UniRef100_E8XNY0 Integral membrane sensor signal transduction h...   130    1e-27 
  UniRef100_W5J1U1 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   130    1e-27 
  UniRef100_U7NEE7 Uncharacterized protein n=1 Tax=Halomonas sp. ...   130    1e-27 
  UniRef100_L8NMF8 Two component sensor histidine kinase in gluco...   130    1e-27 
  UniRef100_E3DGE6 Sensor protein RstB n=1 Tax=Erwinia sp. (strai...   130    1e-27 
  UniRef100_V2J1V6 Osmolarity sensor protein EnvZ n=1 Tax=Cupriav...   130    1e-27 
  UniRef100_L7GC43 Sensor histidine kinase n=3 Tax=Pseudomonas sy...   130    1e-27 
  UniRef100_Y1J642 Sensor protein rstB n=2 Tax=Enterobacter cloac...   130    1e-27 
  UniRef100_N4Q846 Sensor protein rstB n=1 Tax=Escherichia coli P...   130    1e-27 
  UniRef100_T7G1X5 Sensor protein CpxA n=1 Tax=Escherichia coli H...   130    1e-27 
  UniRef100_UPI0001CBF2C6 MULTISPECIES: histidine kinase n=1 Tax=...   130    1e-27 
  UniRef100_W0A4N0 Sensor histidine kinase n=1 Tax=Aeromonas hydr...   130    1e-27 
  UniRef100_F7SLB3 Integral membrane sensor signal transduction h...   130    1e-27 
  UniRef100_UPI0002FC7F5F histidine kinase n=1 Tax=Pseudomonas al...   130    1e-27 
  UniRef100_G7LSR0 Integral membrane sensor signal transduction h...   130    1e-27 
  UniRef100_R0EJF1 Signal transduction histidine kinase n=1 Tax=C...   130    1e-27 
  UniRef100_B5PJJ9 Sensor protein CpxA n=1 Tax=Salmonella enteric...   130    1e-27 
  UniRef100_A0A017IGQ4 Sensor protein rstB n=1 Tax=Escherichia co...   130    1e-27 
  UniRef100_A3D0L3 Integral membrane sensor signal transduction h...   130    1e-27 
  UniRef100_U7CYQ4 Sensor protein rstB n=2 Tax=Enterobacter cloac...   130    1e-27 
  UniRef100_K2U946 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   130    1e-27 
  UniRef100_K1IIC7 Uncharacterized protein n=1 Tax=Aeromonas vero...   130    1e-27 
  UniRef100_H3LP57 Sensor protein rstB n=2 Tax=Klebsiella oxytoca...   130    1e-27 
  UniRef100_X7HLT1 Sensor protein rstB n=1 Tax=Citrobacter freund...   130    1e-27 
  UniRef100_M4ULT5 Osmolarity sensory histidine kinase EnvZ n=1 T...   130    1e-27 
  UniRef100_D8MRS2 Two-component regulatory system, sensor kinase...   130    1e-27 
  UniRef100_D2BYE8 Integral membrane sensor signal transduction h...   130    1e-27 
  UniRef100_F3DE33 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   130    1e-27 
  UniRef100_U1TZH7 Histidine kinase n=1 Tax=Pseudomonas mendocina...   130    1e-27 
  UniRef100_T1X9G2 Putative sensor histidine kinase n=1 Tax=Vario...   130    1e-27 
  UniRef100_H1YRH9 Integral membrane sensor signal transduction h...   130    1e-27 
  UniRef100_I4ZK97 Sensor protein RstB n=9 Tax=Enterobacter cloac...   130    1e-27 
  UniRef100_N9IAU3 Uncharacterized protein n=1 Tax=Acinetobacter ...   130    1e-27 
  UniRef100_U0EUD1 Sensor histidine kinase n=1 Tax=Vibrio coralli...   130    1e-27 
  UniRef100_UPI00016AD440 putative osmolarity sensor protein EnvZ...   130    1e-27 
  UniRef100_W0UZS3 HAMP domain protein n=1 Tax=Janthinobacterium ...   130    1e-27 
  UniRef100_G2ZS11 Putative sensory histidine kinase in two-compo...   130    1e-27 
  UniRef100_UPI00031FACF2 sensor protein RstB n=1 Tax=Enterobacte...   130    1e-27 
  UniRef100_V8A3G9 Histidine kinase n=1 Tax=Asaia sp. SF2.1 RepID...   130    1e-27 
  UniRef100_F8VKZ7 Two-component sensor kinase protein n=1 Tax=Sa...   130    1e-27 
  UniRef100_L7GXK5 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   130    1e-27 
  UniRef100_G0B097 Integral membrane sensor signal transduction h...   130    1e-27 
  UniRef100_W2D6U1 Two component sensor histidine kinase n=1 Tax=...   130    1e-27 
  UniRef100_S5CNV1 Signal transduction histidine kinase n=9 Tax=A...   130    1e-27 
  UniRef100_D8NE89 Putative sensory histidine kinase in two-compo...   130    1e-27 
  UniRef100_A5G0J4 Integral membrane sensor signal transduction h...   130    1e-27 
  UniRef100_U3HCP0 Sensor histidine kinase n=1 Tax=Pseudomonas al...   130    1e-27 
  UniRef100_D7A0Z1 Integral membrane sensor signal transduction h...   130    1e-27 
  UniRef100_D0IAW9 Signal transduction histidine kinase n=1 Tax=G...   130    2e-27 
  UniRef100_S6HAV0 Periplasmic sensor Signal transduction histidi...   130    2e-27 
  UniRef100_V2V1T0 Uncharacterized protein n=1 Tax=Acinetobacter ...   130    2e-27 
  UniRef100_K2TDA3 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   130    2e-27 
  UniRef100_W0UL66 Two-component regulatory system, sensor kinase...   130    2e-27 
  UniRef100_V2TW17 Uncharacterized protein n=1 Tax=Acinetobacter ...   130    2e-27 
  UniRef100_F6AAX8 Histidine kinase n=1 Tax=Pseudomonas fulva (st...   130    2e-27 
  UniRef100_F0J1N0 Putative two-component sensor histidine kinase...   130    2e-27 
  UniRef100_W6VR37 Integral membrane sensor signal transduction h...   130    2e-27 
  UniRef100_I0QV72 Sensor protein RstB n=1 Tax=Serratia sp. M24T3...   130    2e-27 
  UniRef100_A3YD80 Putative Signal transduction histidine kinase ...   130    2e-27 
  UniRef100_X7GF81 Sensor protein RstB n=1 Tax=Serratia marcescen...   130    2e-27 
  UniRef100_U1LXB5 Sensory histidine kinase in two-component regu...   130    2e-27 
  UniRef100_R8YJP8 Sensor protein rstB n=3 Tax=Escherichia coli R...   130    2e-27 
  UniRef100_N9KDJ7 Uncharacterized protein n=3 Tax=Acinetobacter ...   130    2e-27 
  UniRef100_UPI0003780656 histidine kinase n=1 Tax=Erwinia toleta...   130    2e-27 
  UniRef100_F3JBQ6 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   130    2e-27 
  UniRef100_UPI00037E4163 histidine kinase n=1 Tax=Acinetobacter ...   130    2e-27 
  UniRef100_UPI0003B703E8 sensor histidine kinase n=1 Tax=Pseudom...   130    2e-27 
  UniRef100_S6APF6 Putative two-component histidine kinase n=1 Ta...   130    2e-27 
  UniRef100_H8NHG3 Osmolarity sensor protein EnvZ n=3 Tax=Rickett...   130    2e-27 
  UniRef100_V3HZP4 Sensor protein rstB n=1 Tax=Enterobacter cloac...   130    2e-27 
  UniRef100_UPI0002FE221D sensor protein RstB n=1 Tax=Yersinia en...   130    2e-27 
  UniRef100_UPI0002F52B76 sensor histidine kinase n=1 Tax=Pseudom...   130    2e-27 
  UniRef100_V3T3T0 Sensor protein rstB n=2 Tax=Enterobacter cloac...   130    2e-27 
  UniRef100_U2L655 Copper sensory histidine kinase CpxA n=2 Tax=S...   130    2e-27 
  UniRef100_M8P786 Sensor protein CpxA n=1 Tax=Escherichia coli M...   130    2e-27 
  UniRef100_UPI00037FF2F6 hypothetical protein n=1 Tax=Rhizobium ...   130    2e-27 
  UniRef100_S5MX97 Copper sensory histidine kinase CpxA n=1 Tax=S...   130    2e-27 
  UniRef100_C6EEY6 CpxA sensory histidine kinase n=23 Tax=Enterob...   130    2e-27 
  UniRef100_L0KI17 Signal transduction histidine kinase n=1 Tax=M...   130    2e-27 
  UniRef100_N8S967 Uncharacterized protein n=1 Tax=Acinetobacter ...   130    2e-27 
  UniRef100_B7VKA9 Putative sensor histidine kinase n=1 Tax=Vibri...   130    2e-27 
  UniRef100_C8PWV4 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   130    2e-27 
  UniRef100_G8Q5P6 Sensor histidine kinase n=1 Tax=Pseudomonas fl...   130    2e-27 
  UniRef100_B9JMX6 Two-component sensor histidine kinase protein ...   130    2e-27 
  UniRef100_D2TU77 Two-component sensor kinase n=1 Tax=Citrobacte...   130    2e-27 
  UniRef100_K4YCK7 Sensor protein RstB n=4 Tax=Enterobacter RepID...   130    2e-27 
  UniRef100_B7LVD3 Sensory histidine kinase in two-component regu...   130    2e-27 
  UniRef100_D5RQS4 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   129    2e-27 
  UniRef100_V5ZYT2 Two-component sensor kinase n=1 Tax=Serratia m...   129    2e-27 
  UniRef100_N4JFN3 Sensor protein CpxA n=1 Tax=Escherichia coli p...   129    2e-27 
  UniRef100_UPI00037FC648 ATPase n=1 Tax=Pelagibacter ubique RepI...   129    2e-27 
  UniRef100_D2THM4 Two-component sensor kinase n=1 Tax=Citrobacte...   129    2e-27 
  UniRef100_A8GWS5 Osmolarity sensor protein EnvZ n=2 Tax=Rickett...   129    2e-27 
  UniRef100_F3G5V3 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   129    2e-27 
  UniRef100_E4PN91 Two-component sensor n=1 Tax=Marinobacter adha...   129    2e-27 
  UniRef100_D0FSA2 Two-component regulatory system, sensor kinase...   129    2e-27 
  UniRef100_U6Z980 Sensor protein RstB n=1 Tax=Dickeya sp. D s043...   129    2e-27 
  UniRef100_X2LS27 Two-component sensor protein n=157 Tax=Salmone...   129    2e-27 
  UniRef100_I4JY07 Sensor histidine kinase n=2 Tax=Pseudomonas Re...   129    2e-27 
  UniRef100_B2FLS9 Putative two component sensor histidine kinase...   129    2e-27 
  UniRef100_S3NBN6 Two-component system, OmpR family, sensor hist...   129    2e-27 
  UniRef100_L7ZP43 Sensory histidine kinase in two-component regu...   129    2e-27 
  UniRef100_A9MI55 Uncharacterized protein n=2 Tax=Salmonella cho...   129    2e-27 
  UniRef100_B7GZC4 Sensor protein rstB n=23 Tax=Acinetobacter bau...   129    2e-27 
  UniRef100_UPI00036CCC35 hypothetical protein n=1 Tax=Colwellia ...   129    2e-27 
  UniRef100_J8VR06 Sensor signal transduction histidine kinase n=...   129    2e-27 
  UniRef100_A0A010IWT9 HAMP domain protein n=1 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_UPI00031C17B1 sensor protein RstB n=1 Tax=Yersinia en...   129    2e-27 
  UniRef100_S3IY36 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   129    2e-27 
  UniRef100_N8UZY9 Uncharacterized protein n=1 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_E5B5F6 Two component sensor kinase n=1 Tax=Erwinia am...   129    2e-27 
  UniRef100_C9Y9A4 Putative uncharacterized protein n=1 Tax=Curvi...   129    2e-27 
  UniRef100_U5M873 Sensory histidine kinase in two-component regu...   129    2e-27 
  UniRef100_A0A010H4V3 HAMP domain protein n=1 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_A0A009FDA9 HAMP domain protein n=56 Tax=Acinetobacter...   129    2e-27 
  UniRef100_UPI0002BB9FF3 histidine kinase n=1 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_N8P8N9 Uncharacterized protein n=1 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_N3KHL9 Sensor protein CpxA n=1 Tax=Escherichia coli B...   129    2e-27 
  UniRef100_V6PH97 Sensor protein RstB (Fragment) n=1 Tax=Escheri...   129    2e-27 
  UniRef100_M8L4M6 Sensor protein CpxA n=9 Tax=Escherichia coli R...   129    2e-27 
  UniRef100_C9UNH2 Integral membrane sensor signal transduction h...   129    2e-27 
  UniRef100_A0A017HYU3 Sensor protein CpxA n=1 Tax=Escherichia co...   129    2e-27 
  UniRef100_A0A009FZZ8 HAMP domain protein n=6 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_M4R718 Sensory histidine kinase in two-component regu...   129    2e-27 
  UniRef100_N9DLR7 Uncharacterized protein n=1 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_A0A009N185 HAMP domain protein n=3 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_N9ARD3 Uncharacterized protein n=2 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_S6KBJ7 Sensor histidine kinase n=7 Tax=Pseudomonas sy...   129    2e-27 
  UniRef100_UPI00034B9C10 sensor protein RstB n=1 Tax=Erwinia tol...   129    2e-27 
  UniRef100_UPI0002BA2228 histidine kinase, partial n=1 Tax=Acine...   129    2e-27 
  UniRef100_K8BC38 Copper sensory histidine kinase CpxA n=1 Tax=C...   129    2e-27 
  UniRef100_G2CBW8 Sensor protein cpxA n=1 Tax=Escherichia coli S...   129    2e-27 
  UniRef100_A0A013JPF5 HAMP domain protein n=7 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_B5Q529 Sensor protein CpxA n=3 Tax=Salmonella virchow...   129    2e-27 
  UniRef100_V1HBS3 Two-component sensor protein n=1 Tax=Salmonell...   129    2e-27 
  UniRef100_U1ZY19 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   129    2e-27 
  UniRef100_J2T001 Signal transduction histidine kinase n=1 Tax=P...   129    2e-27 
  UniRef100_Q32A76 Histidine protein kinase n=2 Tax=Shigella dyse...   129    2e-27 
  UniRef100_A0A009H7K8 HAMP domain protein n=1 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_A0A013TJT3 HAMP domain protein n=1 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_N9RJQ7 Uncharacterized protein n=1 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_C4SUB0 Putative uncharacterized protein n=1 Tax=Yersi...   129    2e-27 
  UniRef100_A0A009IS45 HAMP domain protein n=12 Tax=Acinetobacter...   129    2e-27 
  UniRef100_A0A009F4Q4 HAMP domain protein n=1 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_W8UJF9 Sensor protein RstB n=1 Tax=Yersinia enterocol...   129    2e-27 
  UniRef100_R9AU21 Two-component system, OmpR family, sensor hist...   129    2e-27 
  UniRef100_UPI00037C6B62 histidine kinase n=1 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_M8I522 Sensory histidine kinase in two-component regu...   129    2e-27 
  UniRef100_J0T5M8 GHKL domain protein n=2 Tax=Acinetobacter baum...   129    2e-27 
  UniRef100_A0A013JWL9 HAMP domain protein n=1 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_A0A009GZZ6 HAMP domain protein n=4 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_UPI0002F2C5D5 histidine kinase n=1 Tax=Pseudomonas to...   129    2e-27 
  UniRef100_C3K0Q2 Putative two component system, sensor kinase n...   129    2e-27 
  UniRef100_A1JHY9 Two component sensor kinase n=2 Tax=Yersinia e...   129    2e-27 
  UniRef100_Y1H8N8 Sensor protein rstB n=1 Tax=Enterobacter sp. B...   129    2e-27 
  UniRef100_U4MGF0 Two-component sensor kinase protein n=1 Tax=Sa...   129    2e-27 
  UniRef100_E1TKE9 Integral membrane sensor signal transduction h...   129    2e-27 
  UniRef100_J2KYP9 Signal transduction histidine kinase n=1 Tax=R...   129    2e-27 
  UniRef100_A9MZE3 Uncharacterized protein n=601 Tax=Salmonella c...   129    2e-27 
  UniRef100_UPI0002D57CF1 histidine kinase n=1 Tax=Pseudoalteromo...   129    2e-27 
  UniRef100_N0BYI4 Two-component sensor protein n=1 Tax=Salmonell...   129    2e-27 
  UniRef100_N9HSJ4 Uncharacterized protein n=1 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_L5WLG1 Two-component sensor protein n=1 Tax=Salmonell...   129    2e-27 
  UniRef100_H4S395 Sensory histidine kinase in two-component regu...   129    2e-27 
  UniRef100_A0A013J6F9 HAMP domain protein n=2 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_A0A009L2C0 HAMP domain protein n=13 Tax=Acinetobacter...   129    2e-27 
  UniRef100_N3GZ88 Sensor protein CpxA n=1 Tax=Escherichia coli P...   129    2e-27 
  UniRef100_D4BEG9 Sensor protein CpxA n=1 Tax=Citrobacter younga...   129    2e-27 
  UniRef100_A6FJ26 Putative Signal transduction histidine kinase ...   129    2e-27 
  UniRef100_A0A009KA45 HAMP domain protein n=2 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_D5VHU3 Integral membrane sensor signal transduction h...   129    2e-27 
  UniRef100_H7EET8 ATPase, histidine kinase-, DNA gyrase B-, and ...   129    2e-27 
  UniRef100_UPI0003177E97 histidine kinase n=1 Tax=Sphingomonas s...   129    2e-27 
  UniRef100_N8QSG9 Uncharacterized protein n=1 Tax=Acinetobacter ...   129    2e-27 
  UniRef100_UPI0003B499FC histidine kinase n=1 Tax=Sphingomonas p...   129    2e-27 
  UniRef100_UPI000237EAA1 histidine kinase n=1 Tax=Komagataeibact...   129    2e-27 
  UniRef100_Y1B569 Sensor protein rstB n=1 Tax=Enterobacter cloac...   129    2e-27 
  UniRef100_Q7U818 Two-component sensor histidine kinase n=1 Tax=...   129    2e-27 
  UniRef100_J2Y726 Sensor histidine kinase n=1 Tax=Pseudomonas fl...   129    2e-27 
  UniRef100_F5RS17 Sensor histidine kinase RstB n=1 Tax=Enterobac...   129    2e-27 
  UniRef100_UPI0003B4E9F5 histidine kinase n=1 Tax=Thalassospira ...   129    3e-27 
  UniRef100_S4YP81 Sensor protein RstB n=3 Tax=Serratia plymuthic...   129    3e-27 
  UniRef100_E7U2W0 Copper sensory histidine kinase CpxA n=2 Tax=E...   129    3e-27 
  UniRef100_A0A011NCU6 HAMP domain protein n=1 Tax=Acinetobacter ...   129    3e-27 
  UniRef100_N3JBN3 Sensor protein CpxA n=1 Tax=Escherichia coli 2...   129    3e-27 
  UniRef100_H0SHY7 Putative two-component sensor histidine kinase...   129    3e-27 
  UniRef100_G5PVG0 Copper sensory histidine kinase CpxA n=1 Tax=S...   129    3e-27 
  UniRef100_A0A009JIC1 HAMP domain protein n=7 Tax=Acinetobacter ...   129    3e-27 
  UniRef100_W8PUW0 Histidine kinase n=1 Tax=Pseudomonas brassicac...   129    3e-27 
  UniRef100_S1LXS8 Sensor protein rstB n=1 Tax=Escherichia coli K...   129    3e-27 
  UniRef100_Q1V0J6 Osmolarity sensor protein envZ n=1 Tax=Candida...   129    3e-27 
  UniRef100_N3AU95 Sensor protein CpxA n=1 Tax=Escherichia coli P...   129    3e-27 
  UniRef100_W8TBI5 Two-component sensor protein n=28 Tax=Escheric...   129    3e-27 
  UniRef100_A0A017I4C6 Sensor protein CpxA n=9 Tax=Escherichia co...   129    3e-27 
  UniRef100_UPI0003EF6480 two-component sensor protein n=1 Tax=Es...   129    3e-27 
  UniRef100_B0KKG9 Integral membrane sensor signal transduction h...   129    3e-27 
  UniRef100_I5CK91 Sensor signal transduction histidine kinase n=...   129    3e-27 
  UniRef100_A0A010K826 HAMP domain protein n=1 Tax=Acinetobacter ...   129    3e-27 
  UniRef100_A0A009MIV0 HAMP domain protein n=10 Tax=Acinetobacter...   129    3e-27 
  UniRef100_UPI000306B16B histidine kinase n=1 Tax=Stenotrophomon...   129    3e-27 
  UniRef100_W4SPG1 Two-component system sensor protein n=1 Tax=Xa...   129    3e-27 
  UniRef100_K8A4C6 Copper sensory histidine kinase CpxA n=1 Tax=C...   129    3e-27 
  UniRef100_UPI000360FF7B sensor protein RstB n=1 Tax=Pantoea sp....   129    3e-27 
  UniRef100_X7FYQ0 Sensor protein CpxA n=1 Tax=Serratia marcescen...   129    3e-27 
  UniRef100_U1W4F0 Sensor protein RstB n=1 Tax=Serratia marcescen...   129    3e-27 
  UniRef100_A0A014NRB0 Two-component sensor protein n=1 Tax=Erwin...   129    3e-27 
  UniRef100_UPI00031B9139 sensor protein RstB n=1 Tax=Serratia ma...   129    3e-27 
  UniRef100_C4U087 Putative uncharacterized protein n=1 Tax=Yersi...   129    3e-27 
  UniRef100_X3DDD3 Two-component sensor protein n=1 Tax=Salmonell...   129    3e-27 
  UniRef100_W6VXU8 Integral membrane sensor signal transduction h...   129    3e-27 
  UniRef100_N9N9J0 Uncharacterized protein n=1 Tax=Acinetobacter ...   129    3e-27 
  UniRef100_F0JXN4 Two-component sensor protein n=6 Tax=Escherich...   129    3e-27 
  UniRef100_A0A009HDH1 HAMP domain protein n=1 Tax=Acinetobacter ...   129    3e-27 
  UniRef100_B2N4I7 Sensor histidine kinase CpxA n=1 Tax=Escherich...   129    3e-27 
  UniRef100_L4PSM5 Sensor protein CpxA n=1 Tax=Escherichia coli K...   129    3e-27 
  UniRef100_F5N8C1 Sensor protein cpxA n=2 Tax=Shigella flexneri ...   129    3e-27 
  UniRef100_A0A009XU99 HAMP domain protein n=1 Tax=Acinetobacter ...   129    3e-27 
  UniRef100_UPI0002BA6312 histidine kinase n=1 Tax=Acinetobacter ...   129    3e-27 
  UniRef100_H3LFK5 Sensor protein CpxA n=2 Tax=Klebsiella oxytoca...   129    3e-27 
  UniRef100_A0A017L6Z7 Sensor protein CpxA n=7 Tax=Escherichia co...   129    3e-27 
  UniRef100_A0A009MS62 HAMP domain protein n=2 Tax=Acinetobacter ...   129    3e-27 
  UniRef100_M4U5P8 Sensor histidine kinase n=1 Tax=Psychromonas s...   129    3e-27 
  UniRef100_B0VUG1 Putative sensory histidine kinase in two-compo...   129    3e-27 
  UniRef100_E3Y8J0 Sensor protein cpxA n=8 Tax=Shigella flexneri ...   129    3e-27 
  UniRef100_A3M2P5 BfmS n=301 Tax=Acinetobacter baumannii RepID=A...   129    3e-27 
  UniRef100_P0AE84 Sensor protein CpxA n=1248 Tax=root RepID=CPXA...   129    3e-27 
  UniRef100_B5S062 Putative two component transmembrane sensor ki...   129    3e-27 
  UniRef100_N4GQQ3 Sensor protein CpxA n=1 Tax=Escherichia coli P...   129    3e-27 
  UniRef100_D3VGA8 Sensory histidine kinase in two-component regu...   129    3e-27 
  UniRef100_I3TTZ5 Two component sensor kinase n=1 Tax=Tistrella ...   129    3e-27 
  UniRef100_A0A016XH86 Histidine kinase n=1 Tax=Hylemonella graci...   129    3e-27 
  UniRef100_UPI0002B94A43 histidine kinase n=1 Tax=Acinetobacter ...   129    3e-27 
  UniRef100_V5VG42 Uncharacterized protein n=1 Tax=Acinetobacter ...   129    3e-27 
  UniRef100_S3MTX3 Two-component sensor histidine kinase in gluco...   129    3e-27 
  UniRef100_H3L8J8 Sensor protein rstB n=3 Tax=Klebsiella RepID=H...   129    3e-27 
  UniRef100_T9F776 Sensor protein CpxA n=1 Tax=Escherichia coli U...   129    3e-27 
  UniRef100_N3Q2S9 Sensor protein CpxA n=2 Tax=Escherichia coli R...   129    3e-27 
  UniRef100_UPI00031B776C histidine kinase n=1 Tax=Halomonas stev...   129    3e-27 
  UniRef100_C4SZA4 Putative uncharacterized protein n=1 Tax=Yersi...   129    3e-27 
  UniRef100_N3FWW9 Sensor protein CpxA n=1 Tax=Escherichia coli P...   129    3e-27 
  UniRef100_M8XEM9 Sensor protein CpxA n=2 Tax=Escherichia coli R...   129    3e-27 
  UniRef100_UPI000299E9B4 histidine kinase n=1 Tax=Pseudomonas ge...   129    3e-27 
  UniRef100_X3WYQ6 Two-component sensor protein n=1 Tax=Salmonell...   129    3e-27 
  UniRef100_V0Y934 Sensor protein CpxA n=1 Tax=Escherichia coli 9...   129    3e-27 
  UniRef100_S6L883 Sensor histidine kinase n=2 Tax=Pseudomonas sy...   129    3e-27 
  UniRef100_L9P3I8 GHKL domain protein n=2 Tax=Acinetobacter baum...   129    3e-27 
  UniRef100_K6GQM3 Signal transduction histidine kinase n=53 Tax=...   129    3e-27 
  UniRef100_UPI0002B9E04E histidine kinase n=1 Tax=Acinetobacter ...   129    3e-27 
  UniRef100_UPI00001659B5 two-component sensor protein n=1 Tax=Es...   129    3e-27 
  UniRef100_UPI00037C2860 histidine kinase n=1 Tax=Acinetobacter ...   129    3e-27 
  UniRef100_UPI000262C7B4 two-component sensor histidine kinase n...   129    3e-27 
  UniRef100_W8PNB5 Histidine kinase n=1 Tax=Pseudomonas brassicac...   129    3e-27 
  UniRef100_F3DQB2 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   129    3e-27 
  UniRef100_A0A010HSS4 HAMP domain protein n=1 Tax=Acinetobacter ...   129    3e-27 
  UniRef100_F3GVT5 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   129    3e-27 
  UniRef100_UPI0000F2F5EF protein BfmS n=1 Tax=Acinetobacter baum...   129    3e-27 
  UniRef100_V5ANT8 Two component transmembrane sensor kinase tran...   129    3e-27 
  UniRef100_L0LEN6 Signal transduction histidine kinase protein n...   129    3e-27 
  UniRef100_V3T323 Uncharacterized protein n=1 Tax=Serratia sp. A...   129    3e-27 
  UniRef100_V6A496 Two-component system sensor kinase n=1 Tax=Ser...   129    3e-27 
  UniRef100_A0A013MBK7 HAMP domain protein n=1 Tax=Acinetobacter ...   129    3e-27 
  UniRef100_N9NZB8 Uncharacterized protein n=2 Tax=Acinetobacter ...   129    3e-27 
  UniRef100_G9Z1W8 Sensor protein CpxA n=1 Tax=Yokenella regensbu...   129    3e-27 
  UniRef100_C4SAA1 Putative uncharacterized protein n=1 Tax=Yersi...   129    3e-27 
  UniRef100_M9M4W8 Two component sensor histidine kinase n=2 Tax=...   129    3e-27 
  UniRef100_R1GRQ4 Sensor histidine kinase n=1 Tax=Aeromonas moll...   129    3e-27 
  UniRef100_UPI00037749A8 histidine kinase n=1 Tax=Acinetobacter ...   129    3e-27 
  UniRef100_I6CDC4 Sensor protein CpxA n=1 Tax=Shigella flexneri ...   129    3e-27 
  UniRef100_G6XJS7 Two component sensor histidine kinase n=1 Tax=...   129    3e-27 
  UniRef100_F7S7C9 Integral membrane sensor signal transduction h...   129    3e-27 
  UniRef100_M4IKM6 Signal transduction histidine kinase n=1 Tax=S...   129    4e-27 
  UniRef100_G0BEN2 Integral membrane sensor signal transduction h...   129    4e-27 
  UniRef100_N8TWP3 Uncharacterized protein n=1 Tax=Acinetobacter ...   129    4e-27 
  UniRef100_M5F359 Sensor protein n=1 Tax=Mesorhizobium sp. STM 4...   129    4e-27 
  UniRef100_N3W6H7 Sensor protein CpxA n=1 Tax=Escherichia coli P...   129    4e-27 
  UniRef100_M8RQ20 Sensor protein CpxA n=1 Tax=Escherichia coli 2...   129    4e-27 
  UniRef100_UPI0002F3082B signal protein n=1 Tax=Sphingomonas sp....   129    4e-27 
  UniRef100_UPI0002D831E3 histidine kinase n=1 Tax=Komagataeibact...   129    4e-27 
  UniRef100_W4S6Y1 Two-component system sensor protein n=2 Tax=Xa...   129    4e-27 
  UniRef100_A0A009J9H4 HAMP domain protein n=1 Tax=Acinetobacter ...   129    4e-27 
  UniRef100_UPI0002D964C1 hypothetical protein n=1 Tax=Pseudomona...   129    4e-27 
  UniRef100_S6AQD3 Uncharacterized protein n=1 Tax=Pseudomonas re...   129    4e-27 
  UniRef100_B2TVQ4 Sensor histidine kinase CpxA n=1 Tax=Shigella ...   129    4e-27 
  UniRef100_K9B9J0 GHKL domain protein n=1 Tax=Acinetobacter baum...   129    4e-27 
  UniRef100_UPI000365B2BF hypothetical protein n=1 Tax=Meganema p...   129    4e-27 
  UniRef100_UPI0002B9F196 sensor protein RstB n=1 Tax=Escherichia...   129    4e-27 
  UniRef100_J1GEX5 Two-component sensor protein n=1 Tax=Enterobac...   129    4e-27 
  UniRef100_A0A011TKR2 Two-component sensor histidine kinase in g...   129    4e-27 
  UniRef100_A0A011QJY8 Sensor protein RstB n=1 Tax=Candidatus Acc...   129    4e-27 
  UniRef100_C6CP91 Histidine kinase n=1 Tax=Dickeya zeae (strain ...   129    4e-27 
  UniRef100_K8RAW1 Integral membrane sensor signal transduction h...   129    4e-27 
  UniRef100_F2ZHG5 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   129    4e-27 
  UniRef100_UPI0003042163 sensor protein RstB n=1 Tax=Dickeya zea...   129    4e-27 
  UniRef100_J0QE61 Uncharacterized protein n=1 Tax=Bartonella dos...   129    4e-27 
  UniRef100_A0A022S958 HAMP domain protein n=1 Tax=Acinetobacter ...   129    4e-27 
  UniRef100_L9U9Z6 ATPase-like, ATP-binding domain n=1 Tax=Halomo...   129    4e-27 
  UniRef100_J3HA61 Signal transduction histidine kinase n=1 Tax=P...   129    4e-27 
  UniRef100_A0A009LR47 HAMP domain protein n=2 Tax=Acinetobacter ...   129    4e-27 
  UniRef100_W8G6A7 Two-component sensor protein n=1 Tax=Yersinia ...   129    4e-27 
  UniRef100_UPI0003739DCB sensor histidine kinase n=1 Tax=Pseudom...   128    4e-27 
  UniRef100_A6EZA8 Probable two-component sensor n=1 Tax=Marinoba...   128    4e-27 
  UniRef100_G8WC50 Two-component sensor protein n=14 Tax=Klebsiel...   128    4e-27 
  UniRef100_UPI0003826E35 sensor histidine kinase n=1 Tax=Pseudom...   128    4e-27 
  UniRef100_A4WG86 Integral membrane sensor signal transduction h...   128    4e-27 
  UniRef100_A7MQ78 Uncharacterized protein n=5 Tax=Cronobacter Re...   128    4e-27 
  UniRef100_C1M4B2 Sensor protein rstB n=1 Tax=Citrobacter sp. 30...   128    4e-27 
  UniRef100_B4SIH2 Integral membrane sensor signal transduction h...   128    4e-27 
  UniRef100_V2YTX2 Sensor protein CpxA n=1 Tax=Klebsiella pneumon...   128    4e-27 
  UniRef100_H2IH23 Signal transduction histidine kinase n=2 Tax=V...   128    4e-27 
  UniRef100_T1XH70 Putative signal transduction histidine kinase ...   128    4e-27 
  UniRef100_V5U5E0 Two-component sensor protein n=3 Tax=Cronobact...   128    4e-27 
  UniRef100_X7G8N3 Sensor protein RstB n=1 Tax=Serratia marcescen...   128    4e-27 
  UniRef100_J7UEC6 Integral membrane sensor signal transduction h...   128    4e-27 
  UniRef100_UPI0002F5D09D histidine kinase n=1 Tax=Pseudomonas to...   128    4e-27 
  UniRef100_S6KZ17 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   128    4e-27 
  UniRef100_A8AL17 Uncharacterized protein n=1 Tax=Citrobacter ko...   128    5e-27 
  UniRef100_N8EQ69 Uncharacterized protein n=1 Tax=Brucella sp. 6...   128    5e-27 
  UniRef100_R8V1J2 Sensor protein CpxA n=2 Tax=Citrobacter RepID=...   128    5e-27 
  UniRef100_UPI0002F836F1 sensor protein RstB n=1 Tax=Serratia ma...   128    5e-27 
  UniRef100_B0SZE3 Integral membrane sensor signal transduction h...   128    5e-27 
  UniRef100_N1JZX4 Two-component regulatory system, sensor kinase...   128    5e-27 
  UniRef100_B5XZ44 Sensor protein CpxA n=11 Tax=Klebsiella RepID=...   128    5e-27 
  UniRef100_H3RD13 Sensory histidine kinase in two-component regu...   128    5e-27 
  UniRef100_G0EAM9 Two-component sensor protein n=10 Tax=Enteroba...   128    5e-27 
  UniRef100_N9PUZ6 Uncharacterized protein n=1 Tax=Acinetobacter ...   128    5e-27 
  UniRef100_N8UYA5 Uncharacterized protein n=1 Tax=Acinetobacter ...   128    5e-27 
  UniRef100_N8S6N1 Uncharacterized protein n=3 Tax=Acinetobacter ...   128    5e-27 
  UniRef100_G0AC74 Putative Signal transduction histidine kinase ...   128    5e-27 
  UniRef100_Q46SD2 Response regulator receiver:ATP-binding region...   128    5e-27 
  UniRef100_J2U944 Signal transduction histidine kinase n=1 Tax=H...   128    5e-27 
  UniRef100_C0Q410 Two-component sensor protein n=1 Tax=Salmonell...   128    5e-27 
  UniRef100_S9TKE8 Signal transduction histidine kinase n=1 Tax=P...   128    5e-27 
  UniRef100_W2E3U6 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   128    5e-27 
  UniRef100_UPI0002F5DB90 histidine kinase n=1 Tax=Xanthomonas ar...   128    5e-27 
  UniRef100_N3TBR9 Sensor protein CpxA n=2 Tax=Escherichia coli R...   128    5e-27 
  UniRef100_E7B8F3 Sensory histidine kinase in two-component regu...   128    5e-27 
  UniRef100_I4KEW2 Sensor histidine kinase n=1 Tax=Pseudomonas fl...   128    5e-27 
  UniRef100_E3I6K2 Integral membrane sensor signal transduction h...   128    5e-27 
  UniRef100_UPI0002EB0666 sensor histidine kinase n=1 Tax=Pseudom...   128    5e-27 
  UniRef100_F0L036 Two-component sensor protein n=2 Tax=Yersinia ...   128    5e-27 
  UniRef100_D1CWH6 Integral membrane sensor signal transduction h...   128    5e-27 
  UniRef100_N9USX6 Periplasmic sensory histidine protein kinase n...   128    5e-27 
  UniRef100_UPI00036FF47F histidine kinase n=1 Tax=Vibrio tasmani...   128    5e-27 
  UniRef100_G2IQX5 Two-component system sensor histidine kinase n...   128    5e-27 
  UniRef100_N9PLG9 Uncharacterized protein n=1 Tax=Acinetobacter ...   128    5e-27 
  UniRef100_C4RW99 Putative uncharacterized protein n=1 Tax=Yersi...   128    5e-27 
  UniRef100_S3F924 Integral membrane sensor signal transduction h...   128    5e-27 
  UniRef100_W0I2H6 Two-component sensor kinase n=1 Tax=Sodalis sp...   128    5e-27 
  UniRef100_S6NAT7 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   128    5e-27 
  UniRef100_M3F175 Uncharacterized protein n=1 Tax=Stenotrophomon...   128    5e-27 
  UniRef100_S6I5N5 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   128    5e-27 
  UniRef100_R5QK31 Uncharacterized protein n=5 Tax=Clostridiales ...   128    5e-27 
  UniRef100_W0UFC3 Two component sensor kinase n=1 Tax=Yersinia e...   128    5e-27 
  UniRef100_J7SXW8 Uncharacterized protein n=1 Tax=Stenotrophomon...   128    5e-27 
  UniRef100_E2MC57 Sensor histidine kinase n=2 Tax=Pseudomonas sy...   128    5e-27 
  UniRef100_K6Z4Z5 Uncharacterized protein n=1 Tax=Glaciecola arc...   128    5e-27 
  UniRef100_A0A023C6M8 Histidine kinase n=1 Tax=Pseudomonas extre...   128    5e-27 
  UniRef100_UPI00031FFA35 histidine kinase n=1 Tax=Serratia marce...   128    5e-27 
  UniRef100_U5MHZ2 Histidine kinase n=5 Tax=Klebsiella pneumoniae...   128    5e-27 
  UniRef100_UPI00030840F5 histidine kinase n=1 Tax=Pseudomonas fl...   128    5e-27 
  UniRef100_S3UBH7 Two-component system, OmpR family, sensor hist...   128    5e-27 
  UniRef100_W0HHS7 Copper sensory histidine kinase CpxA n=1 Tax=C...   128    5e-27 
  UniRef100_UPI000301B076 histidine kinase n=1 Tax=Dickeya zeae R...   128    6e-27 
  UniRef100_W7NZI6 Sensor protein RstB n=1 Tax=Enterobacter sp. D...   128    6e-27 
  UniRef100_D7Y5I9 Sensor protein CpxA n=4 Tax=Escherichia coli R...   128    6e-27 
  UniRef100_N9N9L5 Uncharacterized protein n=1 Tax=Acinetobacter ...   128    6e-27 
  UniRef100_E7AYK5 Copper sensory histidine kinase CpxA n=11 Tax=...   128    6e-27 
  UniRef100_K8AA05 Copper sensory histidine kinase CpxA n=1 Tax=C...   128    6e-27 
  UniRef100_G8WHW1 Sensor protein RstB n=5 Tax=Klebsiella RepID=G...   128    6e-27 
  UniRef100_V3CKJ2 Sensor protein CpxA n=1 Tax=Klebsiella pneumon...   128    6e-27 
  UniRef100_L4NY60 Sensor protein CpxA n=2 Tax=Escherichia coli R...   128    6e-27 
  UniRef100_UPI00037C47E7 histidine kinase n=1 Tax=Escherichia co...   128    6e-27 
  UniRef100_UPI0002FFC566 sensor histidine kinase n=1 Tax=Pseudom...   128    6e-27 
  UniRef100_UPI0002F77471 sensor histidine kinase n=1 Tax=Pseudom...   128    6e-27 
  UniRef100_V9GTB6 Putative two-component histidine kinase n=1 Ta...   128    6e-27 
  UniRef100_L9N944 Histidine kinase A domain / GHKL domain multi-...   128    6e-27 
  UniRef100_B1G0T5 Integral membrane sensor signal transduction h...   128    6e-27 
  UniRef100_UPI00037B2168 hypothetical protein n=2 Tax=unclassifi...   128    6e-27 
  UniRef100_UPI000311C8CA sensor histidine kinase n=1 Tax=Pseudom...   128    6e-27 
  UniRef100_L8MHM7 Integral membrane sensor signal transduction h...   128    6e-27 
  UniRef100_UPI00030A8467 histidine kinase n=1 Tax=Pseudomonas to...   128    6e-27 
  UniRef100_H2IP77 Signal transduction histidine kinase n=1 Tax=R...   128    6e-27 
  UniRef100_X3RWA0 Two-component sensor protein n=1 Tax=Salmonell...   128    6e-27 
  UniRef100_E3G4W1 Integral membrane sensor signal transduction h...   128    6e-27 
  UniRef100_U2AYV6 ATPase n=1 Tax=Pseudomonas sp. EGD-AK9 RepID=U...   128    6e-27 
  UniRef100_V3SAX6 Sensor protein rstB n=2 Tax=Enterobacter cloac...   128    6e-27 
  UniRef100_A1KBM6 Putative sensor histidine kinase n=1 Tax=Azoar...   128    6e-27 
  UniRef100_M3CKB3 Sensor protein RstB n=1 Tax=Serratia marcescen...   128    6e-27 
  UniRef100_E3I4B6 Integral membrane sensor signal transduction h...   128    6e-27 
  UniRef100_A6UMN9 Histidine kinase n=1 Tax=Sinorhizobium medicae...   128    6e-27 
  UniRef100_V5AMK9 Sensor protein rstB n=1 Tax=Enterobacter cloac...   128    6e-27 
  UniRef100_K8CPZ5 Sensory histidine kinase in two-component regu...   128    6e-27 
  UniRef100_W1S8W2 Histidine kinase n=1 Tax=Sphingobium sp. C100 ...   128    6e-27 
  UniRef100_D4DZ83 Sensor protein CpxA n=1 Tax=Serratia odorifera...   128    6e-27 
  UniRef100_I3AK85 Sensor protein RstB n=1 Tax=Serratia plymuthic...   128    6e-27 
  UniRef100_A0A010PAP0 Histidine kinase n=4 Tax=Citrobacter RepID...   128    6e-27 
  UniRef100_L7GUA7 Two-component system sensor protein, osmolarit...   128    6e-27 
  UniRef100_UPI000368DCF1 ATPase n=1 Tax=Rhizobium leguminosarum ...   128    6e-27 
  UniRef100_A4CEI8 Sensor protein RstB n=1 Tax=Pseudoalteromonas ...   128    6e-27 
  UniRef100_W6IJP6 Uncharacterized protein n=1 Tax=Granulibacter ...   128    7e-27 
  UniRef100_F3EF86 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   128    7e-27 
  UniRef100_V5PM49 ATPase-like ATP-binding protein n=1 Tax=Brucel...   128    7e-27 
  UniRef100_C1MFW6 Sensor protein CpxA n=7 Tax=Enterobacteriaceae...   128    7e-27 
  UniRef100_Q48FF8 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   128    7e-27 
  UniRef100_S6MT61 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   128    7e-27 
  UniRef100_F3JZQ9 Sensor histidine kinase n=2 Tax=Pseudomonas am...   128    7e-27 
  UniRef100_E2XWT8 Periplasmic sensor signal transduction histidi...   128    7e-27 
  UniRef100_E0SF64 Sensor protein rstB n=1 Tax=Dickeya dadantii (...   128    7e-27 
  UniRef100_A1JN56 Two-component regulatory system, sensor kinase...   128    7e-27 
  UniRef100_K6JMV5 Two-component sensor protein n=1 Tax=Klebsiell...   128    7e-27 
  UniRef100_F5RR88 Two-component sensor histidine kinase CpxA n=2...   128    7e-27 
  UniRef100_UPI00037EA58B hypothetical protein n=1 Tax=Burkholder...   127    7e-27 
  UniRef100_S5EKT7 Sensor protein RstB n=1 Tax=Serratia liquefaci...   127    7e-27 
  UniRef100_I6RR00 Two-component sensor protein n=1 Tax=Enterobac...   127    7e-27 
  UniRef100_J8VR43 Integral membrane sensor signal transduction h...   127    7e-27 
  UniRef100_I6HF04 Sensor protein CpxA n=1 Tax=Shigella flexneri ...   127    7e-27 
  UniRef100_UPI0002557124 sensor histidine kinase n=1 Tax=Pseudom...   127    7e-27 
  UniRef100_E8VW90 Integral membrane sensor signal transduction h...   127    7e-27 
  UniRef100_V4ND06 Uncharacterized protein n=1 Tax=Asticcacaulis ...   127    7e-27 
  UniRef100_J3DWX3 Signal transduction histidine kinase n=1 Tax=P...   127    7e-27 
  UniRef100_H0J2B5 Integral membrane sensor signal transduction h...   127    7e-27 
  UniRef100_S6I4Q2 Periplasmic sensor Signal transduction histidi...   127    7e-27 
  UniRef100_W0MVF9 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   127    7e-27 
  UniRef100_K1B9Y7 Sensor protein RstB n=1 Tax=Yersinia enterocol...   127    7e-27 
  UniRef100_D7A525 Integral membrane sensor signal transduction h...   127    7e-27 
  UniRef100_B0CHV9 Integral membrane sensor signal transduction h...   127    7e-27 
  UniRef100_A9KH24 Sensor protein n=5 Tax=Coxiella burnetii RepID...   127    7e-27 
  UniRef100_A9N9G5 HAMP domain/His Kinase A (Phosphoacceptor) dom...   127    7e-27 
  UniRef100_UPI00037F0819 histidine kinase n=1 Tax=alpha proteoba...   127    7e-27 
  UniRef100_UPI0002BA9160 sensor protein RstB n=1 Tax=Escherichia...   127    7e-27 
  UniRef100_UPI00024833C8 histidine kinase n=1 Tax=Vibrio ordalii...   127    7e-27 
  UniRef100_K0X3A5 Signal transduction histidine kinase n=1 Tax=P...   127    7e-27 
  UniRef100_J7GK26 Sensor protein RstB n=4 Tax=Enterobacter cloac...   127    7e-27 
  UniRef100_B1ENB5 Sensor histidine kinase RstB n=1 Tax=Escherich...   127    7e-27 
  UniRef100_F4DPU4 Sensor histidine kinase n=1 Tax=Pseudomonas me...   127    7e-27 
  UniRef100_E7PSH6 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   127    7e-27 
  UniRef100_D8MKG5 Sensory kinase in two-component regulatory sys...   127    7e-27 
  UniRef100_G8W6I7 Two-component sensor protein n=25 Tax=Klebsiel...   127    7e-27 
  UniRef100_L8MIT9 Sensor histidine kinase n=1 Tax=Pseudomonas ps...   127    7e-27 
  UniRef100_E7P8J0 Sensor histidine kinase n=2 Tax=Pseudomonas sy...   127    7e-27 
  UniRef100_M5FL66 Sensor protein n=1 Tax=Mesorhizobium sp. STM 4...   127    7e-27 
  UniRef100_M9W2N3 Two-component sensor protein n=2 Tax=Enterobac...   127    7e-27 
  UniRef100_G0BCA9 Integral membrane sensor signal transduction h...   127    8e-27 
  UniRef100_G9RL98 Sensor protein CpxA n=1 Tax=Klebsiella sp. 4_1...   127    8e-27 
  UniRef100_W6WPW8 Integral membrane sensor signal transduction h...   127    8e-27 
  UniRef100_X5ICU3 Sensor histidine kinase n=1 Tax=Pseudomonas pr...   127    8e-27 
  UniRef100_UPI0003480E8C sensor histidine kinase n=1 Tax=Pseudom...   127    8e-27 
  UniRef100_F4DQN2 Integral membrane sensor signal transduction h...   127    8e-27 
  UniRef100_F3EVU8 Sensor histidine kinase (Fragment) n=1 Tax=Pse...   127    8e-27 
  UniRef100_B5XRE2 Sensor protein RstB n=8 Tax=Klebsiella RepID=B...   127    8e-27 
  UniRef100_C9VBU9 Integral membrane sensor signal transduction h...   127    8e-27 
  UniRef100_C9TXN7 Integral membrane sensor signal transduction h...   127    8e-27 
  UniRef100_A6TGB4 Two-component sensor protein n=170 Tax=Bacteri...   127    8e-27 
  UniRef100_V5PT95 ATPase n=2 Tax=Pandoraea RepID=V5PT95_9BURK         127    8e-27 
  UniRef100_K9CSZ7 Uncharacterized protein n=1 Tax=Sphingobium ya...   127    8e-27 
  UniRef100_W8VQH3 Sensor protein cpxA n=1 Tax=Klebsiella pneumon...   127    8e-27 
  UniRef100_N2KAA8 Sensor protein CpxA n=1 Tax=Escherichia coli 2...   127    8e-27 
  UniRef100_M5TQR3 Uncharacterized protein n=1 Tax=Stenotrophomon...   127    8e-27 
  UniRef100_UPI0002BBA722 two-component sensor protein n=1 Tax=Es...   127    8e-27 
  UniRef100_X5G659 Sensor protein RstB n=1 Tax=Enterobacter asbur...   127    8e-27 
  UniRef100_D5CGT8 Two-component system, OmpR family, sensor hist...   127    8e-27 
  UniRef100_M7PP05 Two-component sensor protein n=3 Tax=Klebsiell...   127    8e-27 
  UniRef100_H4YNE2 Sensor protein CpxA n=2 Tax=Escherichia coli R...   127    8e-27 
  UniRef100_U3ATX4 Putative two-component histidine kinase n=1 Ta...   127    8e-27 
  UniRef100_I2EDB7 Two-component sensor protein CpxA n=1 Tax=Cron...   127    8e-27 
  UniRef100_W2DNA0 Putative two component system, sensor kinase n...   127    8e-27 
  UniRef100_S6INZ1 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   127    8e-27 
  UniRef100_UPI0003466AFF hypothetical protein n=1 Tax=Janthinoba...   127    8e-27 
  UniRef100_K0HW24 Integral membrane sensor signal transduction h...   127    8e-27 
  UniRef100_N7N9V3 Uncharacterized protein n=16 Tax=Brucella ovis...   127    8e-27 
  UniRef100_M2TKM4 Sensor histidine kinase n=1 Tax=Pseudomonas st...   127    8e-27 
  UniRef100_Q21UV7 Periplasmic sensor signal transduction histidi...   127    9e-27 
  UniRef100_UPI00035F5D5A sensor protein RstB n=1 Tax=gamma prote...   127    9e-27 
  UniRef100_W6I4D8 Uncharacterized protein n=1 Tax=Granulibacter ...   127    9e-27 
  UniRef100_W0B151 Sensor protein RstB n=1 Tax=Escherichia albert...   127    9e-27 
  UniRef100_N8VSK7 Uncharacterized protein n=1 Tax=Acinetobacter ...   127    9e-27 
  UniRef100_W8UR57 Sensor protein CpxA n=1 Tax=Yersinia enterocol...   127    9e-27 
  UniRef100_C5BC30 Sensor protein CpxA, putative n=1 Tax=Edwardsi...   127    9e-27 
  UniRef100_A8AGY8 Uncharacterized protein n=1 Tax=Citrobacter ko...   127    9e-27 
  UniRef100_N8SPN4 Uncharacterized protein n=1 Tax=Acinetobacter ...   127    9e-27 
  UniRef100_V3GV14 Sensor protein rstB n=2 Tax=Enterobacter cloac...   127    9e-27 
  UniRef100_UPI00036911D6 hypothetical protein n=1 Tax=Hyphomicro...   127    9e-27 
  UniRef100_C4SH07 Putative uncharacterized protein n=1 Tax=Yersi...   127    9e-27 
  UniRef100_R4Y9N3 RstB protein n=1 Tax=Klebsiella pneumoniae Rep...   127    9e-27 
  UniRef100_J6LBY1 Sensor histidine kinase n=1 Tax=Rhodovulum sp....   127    9e-27 
  UniRef100_A0A010CI24 HAMP domain protein n=1 Tax=Acinetobacter ...   127    9e-27 
  UniRef100_UPI0002F1CBC0 sensor histidine kinase n=1 Tax=Pseudom...   127    9e-27 
  UniRef100_K3BSC1 Sensor protein CpxA n=1 Tax=Escherichia coli N...   127    9e-27 
  UniRef100_V5AZD8 Sensor protein CpxA n=1 Tax=Enterobacter cloac...   127    9e-27 
  UniRef100_U7CM85 Sensor protein rstB n=8 Tax=Enterobacter cloac...   127    9e-27 
  UniRef100_J3IE36 Signal transduction histidine kinase n=1 Tax=P...   127    9e-27 
  UniRef100_F3HSY3 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   127    9e-27 
  UniRef100_C4TUW4 Putative uncharacterized protein n=1 Tax=Yersi...   127    9e-27 
  UniRef100_V3DYV2 Sensor protein rstB n=1 Tax=Enterobacter cloac...   127    9e-27 
  UniRef100_A6T8M9 Sensor histidine protein kinase (RstA regulato...   127    9e-27 
  UniRef100_C4UIX2 Putative uncharacterized protein n=1 Tax=Yersi...   127    9e-27 
  UniRef100_UPI000237DB06 histidine kinase n=1 Tax=Komagataeibact...   127    1e-26 
  UniRef100_K5YGF8 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   127    1e-26 
  UniRef100_UPI000377BD38 hypothetical protein n=1 Tax=Methylover...   127    1e-26 
  UniRef100_UPI0002482A67 histidine kinase n=1 Tax=Escherichia sp...   127    1e-26 
  UniRef100_G0GNS8 Sensor protein RstB n=3 Tax=Klebsiella pneumon...   127    1e-26 
  UniRef100_F5RET7 Sensor protein n=1 Tax=Methyloversatilis unive...   127    1e-26 
  UniRef100_M5JV95 Integral membrane sensor signal transduction h...   127    1e-26 
  UniRef100_W6IQ59 Uncharacterized protein n=1 Tax=Granulibacter ...   127    1e-26 
  UniRef100_A4XX36 Integral membrane sensor signal transduction h...   127    1e-26 
  UniRef100_L5VHH1 Two-component sensor protein n=2 Tax=Escherich...   127    1e-26 
  UniRef100_J3GG12 Signal transduction histidine kinase n=1 Tax=P...   127    1e-26 
  UniRef100_J2MW11 Signal transduction histidine kinase n=1 Tax=P...   127    1e-26 
  UniRef100_B4W9K2 ATPase, histidine kinase-, DNA gyrase B-, and ...   127    1e-26 
  UniRef100_G8SSU1 Integral membrane sensor signal transduction h...   127    1e-26 
  UniRef100_R8XAX9 Sensor protein rstB n=1 Tax=Klebsiella sp. KTE...   127    1e-26 
  UniRef100_A0A010TDU1 Sensor histidine kinase n=1 Tax=Pseudomona...   127    1e-26 
  UniRef100_V3NMC1 Sensor protein CpxA n=1 Tax=Enterobacter sp. M...   127    1e-26 
  UniRef100_M5CJ95 Two-component system, OmpR family, sensor hist...   127    1e-26 
  UniRef100_UPI000290F82A sensor histidine kinase n=1 Tax=Pseudom...   127    1e-26 
  UniRef100_K8DG55 Copper sensory histidine kinase CpxA n=1 Tax=C...   127    1e-26 
  UniRef100_A0A017J8Y2 Sensor protein CpxA n=1 Tax=Escherichia co...   127    1e-26 
  UniRef100_S3IJU3 Sensor protein CpxA n=1 Tax=Cedecea davisae DS...   127    1e-26 
  UniRef100_I2B9X8 Sensor histidine protein kinase n=1 Tax=Shimwe...   127    1e-26 
  UniRef100_J2D6C8 Signal transduction histidine kinase n=1 Tax=R...   127    1e-26 
  UniRef100_W0AU89 Two-component sensor protein n=2 Tax=Escherich...   127    1e-26 
  UniRef100_U6ZYU5 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   127    1e-26 
  UniRef100_UPI00036390D9 hypothetical protein n=1 Tax=Methylosin...   127    1e-26 
  UniRef100_A8GF02 Integral membrane sensor signal transduction h...   127    1e-26 
  UniRef100_UPI00016A59B6 ATPase n=1 Tax=Burkholderia ubonensis R...   127    1e-26 
  UniRef100_B9JKB8 Two-component sensor histidine kinase protein ...   127    1e-26 
  UniRef100_U7CU16 Sensor protein CpxA n=13 Tax=Enterobacter cloa...   127    1e-26 
  UniRef100_K8YZP5 Two-component system sensor histidine kinase n...   127    1e-26 
  UniRef100_M8LQW4 Sensor protein CpxA n=3 Tax=Escherichia coli R...   127    1e-26 
  UniRef100_UPI00037CCFB2 sensor protein RstB n=1 Tax=Klebsiella ...   127    1e-26 
  UniRef100_V3KS45 Sensor protein rstB n=1 Tax=Klebsiella pneumon...   127    1e-26 
  UniRef100_A8F1K0 Osmolarity sensor protein EnvZ n=1 Tax=Rickett...   127    1e-26 
  UniRef100_M4JWY8 Putative two-component system sensor kinase n=...   127    1e-26 
  UniRef100_N7N3G9 Uncharacterized protein n=15 Tax=Brucella ovis...   127    1e-26 
  UniRef100_C4T5D5 Putative uncharacterized protein n=1 Tax=Yersi...   127    1e-26 
  UniRef100_G8LLR7 Sensor protein CpxA n=5 Tax=Enterobacter cloac...   127    1e-26 
  UniRef100_UPI00036B8C2A hypothetical protein n=1 Tax=alpha prot...   127    1e-26 
  UniRef100_UPI0002E680FA sensor histidine kinase n=1 Tax=Moritel...   127    1e-26 
  UniRef100_W5YCM0 Integral membrane sensor signal transduction h...   127    1e-26 
  UniRef100_C4WFE3 Integral membrane sensor signal transduction h...   127    1e-26 
  UniRef100_Q47ZA4 Sensor histidine kinase n=1 Tax=Colwellia psyc...   127    1e-26 
  UniRef100_UPI00031F2CC1 histidine kinase n=1 Tax=Yersinia enter...   127    1e-26 
  UniRef100_E2PRK2 Osmolarity sensor protein ENVZ n=1 Tax=Brucell...   127    1e-26 
  UniRef100_G2S6K4 Integral membrane sensor signal transduction h...   127    1e-26 
  UniRef100_D9QMX6 Integral membrane sensor signal transduction h...   127    1e-26 
  UniRef100_Y1MSG2 Sensor protein CpxA n=1 Tax=Enterobacter sp. M...   127    1e-26 
  UniRef100_V3RIE8 Sensor protein CpxA n=2 Tax=Enterobacter cloac...   127    1e-26 
  UniRef100_M5Q9K2 Sensor protein RstB n=3 Tax=Klebsiella pneumon...   127    1e-26 
  UniRef100_W9BGI0 RstB protein n=174 Tax=Enterobacteriaceae RepI...   127    1e-26 
  UniRef100_UPI00036F3B7B histidine kinase n=1 Tax=Enterobacteria...   127    1e-26 
  UniRef100_A0A011Q8F8 Sensor protein RstB n=1 Tax=Candidatus Acc...   127    1e-26 
  UniRef100_S0AK84 Sensor protein CpxA n=2 Tax=Serratia plymuthic...   127    1e-26 
  UniRef100_Q2NQW9 Two-component sensor kinase n=1 Tax=Sodalis gl...   127    1e-26 
  UniRef100_UPI00031FD02C histidine kinase n=1 Tax=Pseudomonas to...   127    1e-26 
  UniRef100_I7AAW6 Sensor histidine kinase n=1 Tax=Pseudomonas st...   127    1e-26 
  UniRef100_T0H6H6 Uncharacterized protein n=1 Tax=Sphingobium la...   127    1e-26 
  UniRef100_J1YHT9 Sensor protein rstB n=1 Tax=Kosakonia radicinc...   127    1e-26 
  UniRef100_R1IM25 Integral membrane sensor signal transduction h...   127    1e-26 
  UniRef100_J0Y9A3 Putative two component system, sensor kinase n...   127    1e-26 
  UniRef100_K2SZ81 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   127    1e-26 
  UniRef100_I4CSF0 Sensor histidine kinase n=1 Tax=Pseudomonas st...   127    1e-26 
  UniRef100_Q3AIJ7 Periplasmic sensor signal transduction histidi...   127    1e-26 
  UniRef100_I4L3X8 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   127    1e-26 
  UniRef100_Y1G7H5 Sensor protein CpxA n=1 Tax=Enterobacter cloac...   127    1e-26 
  UniRef100_V4S135 Sensor histidine kinase n=1 Tax=Pseudomonas ch...   127    1e-26 
  UniRef100_J3DRJ5 Signal transduction histidine kinase n=1 Tax=P...   127    1e-26 
  UniRef100_V7E108 Signal transduction histidine kinase n=1 Tax=P...   127    1e-26 
  UniRef100_I9WUZ4 Integral membrane sensor signal transduction h...   127    1e-26 
  UniRef100_F9TCP6 Signal transduction histidine kinase n=2 Tax=V...   127    1e-26 
  UniRef100_D2U349 Two-component system, OmpR family, sensor hist...   127    1e-26 
  UniRef100_D6DNV0 Signal transduction histidine kinase n=11 Tax=...   127    1e-26 
  UniRef100_F3GAW5 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   127    1e-26 
  UniRef100_B8DS41 Integral membrane sensor signal transduction h...   127    1e-26 
  UniRef100_W0SZ92 Two-component system sensor kinase n=1 Tax=Ser...   127    1e-26 
  UniRef100_UPI00037FE76F ATPase n=1 Tax=Cupriavidus sp. BIS7 Rep...   127    1e-26 
  UniRef100_Q07YL5 Periplasmic sensor signal transduction histidi...   127    2e-26 
  UniRef100_V2UZH8 Uncharacterized protein n=1 Tax=Acinetobacter ...   127    2e-26 
  UniRef100_D2ZBR1 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   127    2e-26 
  UniRef100_A0A014ET06 HAMP domain protein n=1 Tax=Acinetobacter ...   127    2e-26 
  UniRef100_UPI000302F867 sensor histidine kinase n=1 Tax=Pseudom...   127    2e-26 
  UniRef100_X5GUV3 Two-component sensor protein n=6 Tax=Enterobac...   127    2e-26 
  UniRef100_M8PI20 Sensor protein CpxA n=12 Tax=Escherichia coli ...   127    2e-26 
  UniRef100_M7P7A3 Sensor protein RstB n=2 Tax=Klebsiella RepID=M...   127    2e-26 
  UniRef100_V3PTH5 Sensor protein CpxA n=1 Tax=Enterobacter sp. M...   126    2e-26 
  UniRef100_B9B7R1 Periplasmic sensor signal transduction histidi...   126    2e-26 
  UniRef100_B8L170 Sensor kinase RpeA n=1 Tax=Stenotrophomonas sp...   126    2e-26 
  UniRef100_UPI000190C699 histidine kinase n=1 Tax=Salmonella cho...   126    2e-26 
  UniRef100_I4XZL6 Sensor histidine kinase n=1 Tax=Pseudomonas ch...   126    2e-26 
  UniRef100_J7GNW7 Two-component sensor protein n=4 Tax=Enterobac...   126    2e-26 
  UniRef100_U1SQ48 Sensor histidine kinase n=1 Tax=Pseudomonas me...   126    2e-26 
  UniRef100_J2X8U6 Signal transduction histidine kinase n=1 Tax=P...   126    2e-26 
  UniRef100_UPI0002F741A0 histidine kinase n=3 Tax=Vibrio ordalii...   126    2e-26 
  UniRef100_I4ZET0 Two-component sensor protein n=14 Tax=Enteroba...   126    2e-26 
  UniRef100_UPI00036D06B4 histidine kinase n=1 Tax=gamma proteoba...   126    2e-26 
  UniRef100_UPI0002B415D3 PREDICTED: sensor protein CpxA-like n=1...   126    2e-26 
  UniRef100_F7YK10 CpxA n=4 Tax=Vibrio RepID=F7YK10_VIBA7              126    2e-26 
  UniRef100_UPI0001E285B9 sensor histidine kinase n=1 Tax=Pseudom...   126    2e-26 
  UniRef100_T5KSA4 Histidine kinase n=1 Tax=Stenotrophomonas malt...   126    2e-26 
  UniRef100_N2NT18 Sensor protein CpxA n=2 Tax=Escherichia coli R...   126    2e-26 
  UniRef100_J3IL06 Signal transduction histidine kinase n=1 Tax=P...   126    2e-26 
  UniRef100_D2ZM11 Sensor protein CpxA n=1 Tax=Enterobacter cance...   126    2e-26 
  UniRef100_J2U0C2 Signal transduction histidine kinase n=1 Tax=P...   126    2e-26 
  UniRef100_Q3K8C3 Putative two component system, sensor kinase n...   126    2e-26 
  UniRef100_UPI000382DA6B hypothetical protein n=1 Tax=Pusillimon...   126    2e-26 
  UniRef100_A7II23 Integral membrane sensor signal transduction h...   126    2e-26 
  UniRef100_A0A011Q019 Sensor protein RstB n=1 Tax=Candidatus Acc...   126    2e-26 
  UniRef100_S9ZSH3 Uncharacterized protein n=1 Tax=Thauera terpen...   126    2e-26 
  UniRef100_V8QPR8 ATPase n=1 Tax=Advenella kashmirensis W13003 R...   126    2e-26 
  UniRef100_F1ZDL7 Periplasmic sensor signal transduction histidi...   126    2e-26 
  UniRef100_Y1LQ08 Sensor protein rstB n=2 Tax=Enterobacter cloac...   126    2e-26 
  UniRef100_W8XFA3 Sensory histidine kinase in two-component regu...   126    2e-26 
  UniRef100_C4T3B1 Signal transduction histidine kinase n=1 Tax=Y...   126    2e-26 
  UniRef100_W2DNE4 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   126    2e-26 
  UniRef100_M8PR42 Sensor protein CpxA n=1 Tax=Escherichia coli B...   126    2e-26 
  UniRef100_V3PP81 Sensor protein rstB n=1 Tax=Enterobacter sp. M...   126    2e-26 
  UniRef100_V8DKN7 Sensor histidine kinase n=1 Tax=Pseudomonas ch...   126    2e-26 
  UniRef100_L9M9Z1 GHKL domain protein n=1 Tax=Acinetobacter sp. ...   126    2e-26 
  UniRef100_H8FNZ8 Putative two-component sensor histidine-kinase...   126    2e-26 
  UniRef100_V0AQH1 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   126    2e-26 
  UniRef100_U1TDM1 Histidine kinase n=1 Tax=Pseudomonas fluoresce...   126    2e-26 
  UniRef100_D4FAR8 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   126    2e-26 
  UniRef100_H5V419 Two-component histidine kinase CpxA n=1 Tax=Es...   126    2e-26 
  UniRef100_UPI00029B0FBE histidine kinase n=1 Tax=Pseudomonas sp...   126    2e-26 
  UniRef100_J2NGG3 Signal transduction histidine kinase n=1 Tax=P...   126    2e-26 
  UniRef100_J2UT05 Signal transduction histidine kinase n=1 Tax=P...   126    2e-26 
  UniRef100_UPI00029A02A9 two component sensor histidine kinase n...   126    2e-26 
  UniRef100_I4KNC5 Sensor histidine kinase n=2 Tax=Pseudomonas Re...   126    2e-26 
  UniRef100_J2E8X9 Sensor histidine kinase n=2 Tax=Pseudomonas Re...   126    2e-26 
  UniRef100_J2XZ34 Sensor histidine kinase n=1 Tax=Pseudomonas ch...   126    2e-26 
  UniRef100_C4UTQ5 Putative uncharacterized protein n=1 Tax=Yersi...   126    2e-26 
  UniRef100_A0A013VC59 Nickel transporter n=1 Tax=Sphingobium sp....   126    2e-26 
  UniRef100_D0ZGW4 Two-component sensor protein n=3 Tax=Edwardsie...   126    2e-26 
  UniRef100_V3DK79 Sensor protein rstB n=1 Tax=Klebsiella pneumon...   126    2e-26 
  UniRef100_I4XZP0 Sensor histidine kinase n=1 Tax=Pseudomonas ch...   126    2e-26 
  UniRef100_W5ILR4 ATPase n=1 Tax=Pseudomonas sp. (strain M1) Rep...   126    2e-26 
  UniRef100_L7FR21 Sensor histidine kinase n=3 Tax=Pseudomonas sy...   126    2e-26 
  UniRef100_L0MC00 Signal transduction histidine kinase n=1 Tax=E...   126    2e-26 
  UniRef100_H6QJC8 Osmolarity sensor protein EnvZ n=1 Tax=Rickett...   126    2e-26 
  UniRef100_I4KA01 Sensor histidine kinase n=1 Tax=Pseudomonas fl...   126    2e-26 
  UniRef100_H0SJ56 Putative two component sensor histidine kinase...   126    2e-26 
  UniRef100_D0S179 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   126    2e-26 
  UniRef100_A3JEV7 Sensor histidine kinase n=1 Tax=Marinobacter s...   126    2e-26 
  UniRef100_UPI0003799FF2 histidine kinase n=1 Tax=Acinetobacter ...   126    2e-26 
  UniRef100_U1LB25 Sensory histidine kinase in two-component regu...   126    2e-26 
  UniRef100_UPI00029AC4E0 sensor histidine kinase n=1 Tax=Pseudom...   126    2e-26 
  UniRef100_S0U3B3 Sensor protein rstB n=1 Tax=Escherichia coli K...   126    2e-26 
  UniRef100_UPI0003A98448 histidine kinase n=1 Tax=Xanthomonas sp...   126    2e-26 
  UniRef100_UPI00036EDF72 ATPase n=1 Tax=Rhizobium leguminosarum ...   126    2e-26 
  UniRef100_A5VZA2 Integral membrane sensor signal transduction h...   126    2e-26 
  UniRef100_UPI00037233A5 sensor histidine kinase n=1 Tax=Pseudom...   126    2e-26 
  UniRef100_UPI000362093A histidine kinase n=1 Tax=Rhizobium legu...   126    2e-26 
  UniRef100_A2WGH3 Signal transduction histidine kinase n=1 Tax=B...   126    2e-26 
  UniRef100_W7VV74 Osmolarity sensor protein EnvZ n=3 Tax=Methyli...   126    2e-26 
  UniRef100_K8DJC6 Sensory histidine kinase in two-component regu...   126    2e-26 
  UniRef100_UPI0002B94D8F sensor protein RstB n=1 Tax=Escherichia...   126    2e-26 
  UniRef100_I3ANA2 Two-component sensor protein n=1 Tax=Serratia ...   126    2e-26 
  UniRef100_B5WJG8 Integral membrane sensor signal transduction h...   126    2e-26 
  UniRef100_K7T6F8 Two component sensor histidine kinase n=1 Tax=...   126    2e-26 
  UniRef100_UPI0003725E74 hypothetical protein n=1 Tax=Azoarcus t...   126    2e-26 
  UniRef100_X7HH32 Sensor protein CpxA n=1 Tax=Citrobacter freund...   126    2e-26 
  UniRef100_D7I2J0 Sensor histidine kinase n=1 Tax=Pseudomonas sa...   126    2e-26 
  UniRef100_A4JN66 Integral membrane sensor signal transduction h...   126    2e-26 
  UniRef100_E8YU27 Integral membrane sensor signal transduction h...   126    2e-26 
  UniRef100_U2BVA0 Sensor protein RstB n=2 Tax=Klebsiella pneumon...   126    2e-26 
  UniRef100_D0JCE0 Two component sensor kinase n=1 Tax=Yersinia p...   126    2e-26 
  UniRef100_UPI000372334F histidine kinase n=1 Tax=Pseudomonas fu...   126    2e-26 
  UniRef100_V8R3D2 Sensor histidine kinase n=1 Tax=Pseudomonas mo...   126    2e-26 
  UniRef100_N9DJX3 Uncharacterized protein n=1 Tax=Acinetobacter ...   126    2e-26 
  UniRef100_UPI00029A9578 histidine kinase n=1 Tax=Pseudoalteromo...   126    2e-26 
  UniRef100_H7C7E5 Sensor protein n=2 Tax=Coxiella burnetii RepID...   126    2e-26 
  UniRef100_J7SNQ0 Integral membrane sensor signal transduction h...   126    2e-26 
  UniRef100_W0L8K9 Histidine kinase n=1 Tax=Serratia fonticola RB...   126    3e-26 
  UniRef100_M5EIS0 Sensor protein n=1 Tax=Mesorhizobium metallidu...   126    3e-26 
  UniRef100_Q1I5I7 Putative sensor histidine kinase n=1 Tax=Pseud...   126    3e-26 
  UniRef100_K0DTX4 Integral membrane sensor signal transduction h...   126    3e-26 
  UniRef100_M5D388 Integral membrane sensor signal transduction h...   126    3e-26 
  UniRef100_A4TSB4 Two component sensor kinase n=90 Tax=Yersinia ...   126    3e-26 
  UniRef100_N8N1H4 Uncharacterized protein n=1 Tax=Acinetobacter ...   126    3e-26 
  UniRef100_V8DK92 Sensor histidine kinase n=1 Tax=Pseudomonas ch...   125    3e-26 
  UniRef100_S7C5A2 GHKL domain protein n=1 Tax=Klebsiella pneumon...   125    3e-26 
  UniRef100_UPI00036E916E hypothetical protein n=1 Tax=Curvibacte...   125    3e-26 
  UniRef100_UPI0002631DA7 histidine kinase n=1 Tax=Sphingomonas e...   125    3e-26 
  UniRef100_A9I8D4 Two-component sensor kinase n=1 Tax=Bordetella...   125    3e-26 
  UniRef100_A0A011W526 Two-component sensor histidine kinase RstB...   125    3e-26 
  UniRef100_UPI00037F73AA histidine kinase n=2 Tax=Acinetobacter ...   125    3e-26 
  UniRef100_UPI0002377524 histidine kinase n=1 Tax=Acidovorax rad...   125    3e-26 
  UniRef100_R7WVU2 Histidine kinase n=1 Tax=Pandoraea sp. SD6-2 R...   125    3e-26 
  UniRef100_K9NN03 Sensor histidine kinase n=2 Tax=Pseudomonas Re...   125    3e-26 
  UniRef100_W0LF81 Sensor protein RstB n=1 Tax=Serratia fonticola...   125    3e-26 
  UniRef100_W9TSR9 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   125    3e-26 
  UniRef100_Q0BQV3 Two component system histidine kinase n=1 Tax=...   125    3e-26 
  UniRef100_M2B6X8 Periplasmic sensor signal transduction histidi...   125    3e-26 
  UniRef100_V9ZU71 Sensor protein cpxA n=1 Tax=Klebsiella pneumon...   125    3e-26 
  UniRef100_F4LC59 Two-component sensor kinase n=34 Tax=Bordetell...   125    3e-26 
  UniRef100_S6KYP0 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   125    3e-26 
  UniRef100_UPI00037EAC22 ATPase n=1 Tax=Burkholderia sp. WSM4176...   125    3e-26 
  UniRef100_K8BYF8 Sensory histidine kinase in two-component regu...   125    3e-26 
  UniRef100_UPI0003745E48 hypothetical protein n=1 Tax=Methylopil...   125    3e-26 
  UniRef100_U3QWC5 Osmolarity sensor protein EnvZ n=1 Tax=Ralston...   125    3e-26 
  UniRef100_W6X930 Integral membrane sensor signal transduction h...   125    3e-26 
  UniRef100_V3HD05 Sensor protein CpxA n=1 Tax=Enterobacter cloac...   125    3e-26 
  UniRef100_X5J2P1 Two-component sensor n=2 Tax=Bordetella bronch...   125    3e-26 
  UniRef100_A8GLB4 Integral membrane sensor signal transduction h...   125    3e-26 
  UniRef100_J2P3Z8 Signal transduction histidine kinase n=1 Tax=P...   125    3e-26 
  UniRef100_W0PD03 Putative sensor histidine kinase n=1 Tax=Adven...   125    3e-26 
  UniRef100_L8NE35 Two component sensory histidine kinase RstB n=...   125    3e-26 
  UniRef100_K0MFI1 Putative two-component sensor n=1 Tax=Bordetel...   125    3e-26 
  UniRef100_I2DVY9 Periplasmic sensor signal transduction histidi...   125    3e-26 
  UniRef100_C0REF6 Integral membrane sensor signal transduction h...   125    3e-26 
  UniRef100_UPI0002885A23 histidine kinase n=1 Tax=Pseudomonas sp...   125    3e-26 
  UniRef100_N9AAB6 Uncharacterized protein n=2 Tax=Acinetobacter ...   125    3e-26 
  UniRef100_A0A011UQU9 ATPase n=1 Tax=Ochrobactrum anthropi RepID...   125    3e-26 
  UniRef100_D5QHI0 Putative sensor signal transduction histidine ...   125    3e-26 
  UniRef100_W6QSI5 Sensor histidine kinase n=2 Tax=Pseudomonas ps...   125    3e-26 
  UniRef100_D6JSG2 Putative uncharacterized protein n=1 Tax=Acine...   125    3e-26 
  UniRef100_S2EP95 Signal transduction histidine kinase n=1 Tax=P...   125    3e-26 
  UniRef100_K2SZE5 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   125    3e-26 
  UniRef100_W3T311 HAMP domain protein n=1 Tax=Acinetobacter baum...   125    3e-26 
  UniRef100_V7E683 Signal transduction histidine kinase n=1 Tax=P...   125    3e-26 
  UniRef100_A0A009I9R0 HAMP domain protein n=1 Tax=Acinetobacter ...   125    3e-26 
  UniRef100_I4JJ94 Sensor histidine kinase n=1 Tax=Pseudomonas st...   125    3e-26 
  UniRef100_F3HNF7 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   125    3e-26 
  UniRef100_UPI000248699D histidine kinase n=1 Tax=Acinetobacter ...   125    3e-26 
  UniRef100_U2T9T7 Sensor histidine kinase n=1 Tax=Pseudomonas pu...   125    3e-26 
  UniRef100_A0A013SKK6 HAMP domain protein n=1 Tax=Acinetobacter ...   125    3e-26 
  UniRef100_UPI000378906E histidine kinase n=1 Tax=Stenotrophomon...   125    3e-26 
  UniRef100_UPI0002EBB249 sensor histidine kinase n=1 Tax=Pseudom...   125    3e-26 
  UniRef100_S6GPV9 Uncharacterized protein n=1 Tax=Osedax symbion...   125    3e-26 
  UniRef100_J9DJ35 Uncharacterized protein n=1 Tax=alpha proteoba...   125    3e-26 
  UniRef100_A0A009RGX8 HAMP domain protein n=8 Tax=Acinetobacter ...   125    3e-26 
  UniRef100_A0A010MC27 HAMP domain protein n=2 Tax=Acinetobacter ...   125    3e-26 
  UniRef100_A0A009HE70 HAMP domain protein n=5 Tax=Acinetobacter ...   125    3e-26 
  UniRef100_UPI0003B6879B histidine kinase n=1 Tax=Sphingobium sp...   125    3e-26 
  UniRef100_UPI00036A0C64 MULTISPECIES: hypothetical protein n=1 ...   125    3e-26 
  UniRef100_Q4ZQ25 ATP-binding region, ATPase-like:Histidine kina...   125    3e-26 
  UniRef100_R9NM30 Two-component sensor protein n=1 Tax=Erwinia t...   125    3e-26 
  UniRef100_C9Y372 Sensor protein cpxA n=2 Tax=Cronobacter turice...   125    3e-26 
  UniRef100_J2YED3 Signal transduction histidine kinase n=1 Tax=P...   125    3e-26 
  UniRef100_UPI0003628763 histidine kinase n=1 Tax=Dickeya zeae R...   125    4e-26 
  UniRef100_R8Z280 Uncharacterized protein n=1 Tax=Acinetobacter ...   125    4e-26 
  UniRef100_J0PFA6 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   125    4e-26 
  UniRef100_E8TTZ1 ATP-binding region ATPase domain protein n=2 T...   125    4e-26 
  UniRef100_D2BZF6 Integral membrane sensor signal transduction h...   125    4e-26 
  UniRef100_B4SKL1 Integral membrane sensor signal transduction h...   125    4e-26 
  UniRef100_K4T5U3 Putative two-component sensor n=1 Tax=Bordetel...   125    4e-26 
  UniRef100_A0A010FTR3 HAMP domain protein n=3 Tax=Acinetobacter ...   125    4e-26 
  UniRef100_Q1JYZ6 Periplasmic sensor signal transduction histidi...   125    4e-26 
  UniRef100_N8PX56 Uncharacterized protein n=1 Tax=Acinetobacter ...   125    4e-26 
  UniRef100_A0A011J772 HAMP domain protein n=1 Tax=Acinetobacter ...   125    4e-26 
  UniRef100_UPI0003B407AF histidine kinase n=1 Tax=Perlucidibaca ...   125    4e-26 
  UniRef100_Q39AJ6 Periplasmic sensor signal transduction histidi...   125    4e-26 
  UniRef100_K2M355 Two-component sensor histidine kinase n=1 Tax=...   125    4e-26 
  UniRef100_W0ALN9 Uncharacterized protein n=1 Tax=Sphingomonas s...   125    4e-26 
  UniRef100_D4GF45 RstB n=5 Tax=Pantoea ananas RepID=D4GF45_PANAM      125    4e-26 
  UniRef100_S7TL84 Integral membrane sensor signal transduction h...   125    4e-26 
  UniRef100_UPI0003816445 MULTISPECIES: sensor histidine kinase n...   125    4e-26 
  UniRef100_W7WNK7 Osmolarity sensor protein EnvZ n=1 Tax=Hydroge...   125    4e-26 
  UniRef100_A0A017HJ86 Signal transduction histidine kinase n=1 T...   125    4e-26 
  UniRef100_UPI0002E0C008 sensor histidine kinase n=1 Tax=Pseudom...   125    4e-26 
  UniRef100_U7DPW3 Sensor histidine kinase n=1 Tax=Pseudomonas fl...   125    4e-26 
  UniRef100_N9LBJ3 Uncharacterized protein n=1 Tax=Acinetobacter ...   125    4e-26 
  UniRef100_I9WFH1 Integral membrane sensor signal transduction h...   125    4e-26 
  UniRef100_F2GR20 Integral membrane sensor signal transduction h...   125    4e-26 
  UniRef100_UPI000303A581 sensor histidine kinase n=1 Tax=Pseudom...   125    4e-26 
  UniRef100_U3H3M3 Sensor histidine kinase n=1 Tax=Pseudomonas al...   125    4e-26 
  UniRef100_K2KNB5 Two-component sensor histidine kinase n=1 Tax=...   125    4e-26 
  UniRef100_I5CBU2 Integral membrane sensor signal transduction h...   125    4e-26 
  UniRef100_UPI0002488555 histidine kinase n=1 Tax=Sphingomonas s...   125    4e-26 
  UniRef100_K1JQ18 Uncharacterized protein n=1 Tax=Aeromonas vero...   125    4e-26 
  UniRef100_M1FHE7 Osmolarity sensor protein envZ n=1 Tax=Marinob...   125    4e-26 
  UniRef100_L0NG15 Putative two-component sensor histidine kinase...   125    4e-26 
  UniRef100_I3TVG4 Signal transduction histidine kinase n=1 Tax=T...   125    4e-26 
  UniRef100_G0JW71 Integral membrane sensor signal transduction h...   125    4e-26 
  UniRef100_UPI000372775B histidine kinase n=1 Tax=Psychrobacter ...   125    4e-26 
  UniRef100_M5S9B8 Periplasmic sensor signal transduction histidi...   125    4e-26 
  UniRef100_L7GXB4 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   125    4e-26 
  UniRef100_UPI00036D83F9 hypothetical protein n=1 Tax=Pasteurell...   125    4e-26 
  UniRef100_F5SQ13 Sensor histidine kinase n=1 Tax=Psychrobacter ...   125    4e-26 
  UniRef100_E6V1C2 Integral membrane sensor signal transduction h...   125    4e-26 
  UniRef100_A6WZF5 Integral membrane sensor signal transduction h...   125    4e-26 
  UniRef100_N8XH99 Uncharacterized protein n=1 Tax=Acinetobacter ...   125    4e-26 
  UniRef100_E0LVG2 Integral membrane sensor signal transduction h...   125    4e-26 
  UniRef100_B5IHZ1 Osmolarity sensor protein EnvZ, putative n=1 T...   125    4e-26 
  UniRef100_UPI000381B117 sensor histidine kinase n=1 Tax=Pseudom...   125    4e-26 
  UniRef100_UPI000368D6F7 ATPase n=1 Tax=Pseudomonas mandelii Rep...   125    4e-26 
  UniRef100_I0KJ58 Uncharacterized protein n=2 Tax=Stenotrophomon...   125    4e-26 
  UniRef100_K0MM31 Putative two-component sensor n=1 Tax=Bordetel...   125    4e-26 
  UniRef100_UPI00031B0FDE sensor histidine kinase n=1 Tax=Enterov...   125    4e-26 
  UniRef100_C9NLD9 Copper sensory histidine kinase CpxA n=1 Tax=V...   125    4e-26 
  UniRef100_UPI00037EC72C hypothetical protein n=1 Tax=alpha prot...   125    5e-26 
  UniRef100_B2IIX3 Integral membrane sensor signal transduction h...   125    5e-26 
  UniRef100_G2I6P6 Two component sensor histidine kinase n=1 Tax=...   125    5e-26 
  UniRef100_UPI000371DB35 hypothetical protein n=1 Tax=Enterobact...   125    5e-26 
  UniRef100_B1K664 Histidine kinase n=1 Tax=Burkholderia cenocepa...   125    5e-26 
  UniRef100_A6VVL2 Integral membrane sensor signal transduction h...   125    5e-26 
  UniRef100_N6Y5K7 Putative sensor histidine kinase n=1 Tax=Thaue...   125    5e-26 
  UniRef100_F3IE07 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   125    5e-26 
  UniRef100_D4F5I0 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   125    5e-26 
  UniRef100_Q3SJC3 Periplasmic Sensor Signal Transduction Histidi...   125    5e-26 
  UniRef100_U2M257 Sensory histidine kinase in two-component regu...   125    5e-26 
  UniRef100_U2MIQ8 Sensory histidine kinase in two-component regu...   125    5e-26 
  UniRef100_U1VEL4 Sensor protein RstB n=1 Tax=Pantoea dispersa E...   125    5e-26 
  UniRef100_J2U5A7 Signal transduction histidine kinase n=1 Tax=P...   125    5e-26 
  UniRef100_A2W324 Signal transduction histidine kinase n=1 Tax=B...   125    5e-26 
  UniRef100_UPI000373113A ATPase n=1 Tax=Variovorax paradoxus Rep...   125    5e-26 
  UniRef100_G2I0B3 Two component sensor histidine kinase n=1 Tax=...   125    5e-26 
  UniRef100_F0JP78 Sensor protein RstB n=1 Tax=Escherichia fergus...   125    5e-26 
  UniRef100_C6C4H5 Histidine kinase n=1 Tax=Dickeya dadantii (str...   125    5e-26 
  UniRef100_V5TZK0 Sensor protein RstB n=1 Tax=Cronobacter sakaza...   125    5e-26 
  UniRef100_H8KIA5 Osmolarity sensor protein EnvZ n=1 Tax=Rickett...   125    5e-26 
  UniRef100_W4NM17 Integral membrane sensor signal transduction h...   125    5e-26 
  UniRef100_S6GYI6 Integral membrane sensor signal transduction h...   125    5e-26 
  UniRef100_U7DKG0 Sensor histidine kinase n=1 Tax=Pseudomonas fl...   125    5e-26 
  UniRef100_F0KPL9 Sensory histidine kinase in two-component regu...   125    5e-26 
  UniRef100_U1TP97 Sensor histidine kinase n=1 Tax=Pseudomonas fl...   125    5e-26 
  UniRef100_J7UN22 Integral membrane sensor signal transduction h...   125    5e-26 
  UniRef100_UPI0003495729 histidine kinase n=1 Tax=Ideonella sp. ...   125    5e-26 
  UniRef100_UPI00029B389B sensor histidine kinase n=1 Tax=Pseudom...   125    5e-26 
  UniRef100_Q5FSU4 Two component sensor histidine kinase n=1 Tax=...   125    5e-26 
  UniRef100_F6CV28 Integral membrane sensor signal transduction h...   125    5e-26 
  UniRef100_L0T003 Two-component system, OmpR family, sensor kina...   125    5e-26 
  UniRef100_UPI0002FA33A0 sensor histidine kinase n=1 Tax=Pseudom...   125    5e-26 
  UniRef100_UPI000237DDE5 histidine kinase n=1 Tax=Komagataeibact...   125    5e-26 
  UniRef100_C5CJY7 Histidine kinase n=1 Tax=Variovorax paradoxus ...   125    5e-26 
  UniRef100_F3S4V8 Osmolarity sensor protein envZ n=1 Tax=Glucona...   125    5e-26 
  UniRef100_T2L3Z9 Integral membrane sensor signal transduction h...   125    5e-26 
  UniRef100_UPI0003AB2666 histidine kinase n=1 Tax=Dickeya zeae R...   125    5e-26 
  UniRef100_UPI00036FBF91 hypothetical protein n=1 Tax=Salinimona...   125    5e-26 
  UniRef100_D6CME8 Putative two-component sensor histidine kinase...   125    5e-26 
  UniRef100_J2YC79 Signal transduction histidine kinase n=1 Tax=P...   125    5e-26 
  UniRef100_W1S1G3 Histidine kinase n=1 Tax=Marinomonas sp. D104 ...   125    5e-26 
  UniRef100_S9QXJ2 His Kinase A (Phospho-acceptor) domain/Histidi...   125    5e-26 
  UniRef100_UPI000379FC88 sensor histidine kinase n=1 Tax=Paracoc...   125    6e-26 
  UniRef100_UPI0003730E84 sensor histidine kinase n=1 Tax=Pseudom...   125    6e-26 
  UniRef100_UPI00030308ED sensor histidine kinase n=1 Tax=Enterov...   125    6e-26 
  UniRef100_W6VTZ4 Integral membrane sensor signal transduction h...   125    6e-26 
  UniRef100_J3GRG4 Signal transduction histidine kinase n=1 Tax=P...   125    6e-26 
  UniRef100_A0A021X7E3 Signal transduction histidine kinase n=1 T...   125    6e-26 
  UniRef100_UPI0003728A83 hypothetical protein n=1 Tax=Colwellia ...   125    6e-26 
  UniRef100_V9R1A5 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   125    6e-26 
  UniRef100_F9ZNH9 RsrS n=1 Tax=Acidithiobacillus caldus (strain ...   125    6e-26 
  UniRef100_W1RPU1 Histidine kinase n=1 Tax=Marinomonas sp. D104 ...   125    6e-26 
  UniRef100_T2E5J8 HAMP domain protein n=5 Tax=Pseudomonas aerugi...   125    6e-26 
  UniRef100_UPI000377E3A9 sensor histidine kinase n=1 Tax=Pseudom...   125    6e-26 
  UniRef100_UPI000329BE98 PREDICTED: sensor protein CpxA-like n=1...   125    6e-26 
  UniRef100_K0WJQ3 Signal transduction histidine kinase n=1 Tax=P...   125    6e-26 
  UniRef100_S2K3S0 Integral membrane sensor signal transduction h...   125    6e-26 
  UniRef100_I4N6L3 Integral membrane sensor signal transduction h...   125    6e-26 
  UniRef100_K8ZP30 GHKL domain protein n=1 Tax=Acinetobacter baum...   125    6e-26 
  UniRef100_Q12RS8 ATP-binding region, ATPase-like protein n=1 Ta...   125    6e-26 
  UniRef100_M4K8J0 Putative two component system, sensor kinase n...   125    6e-26 
  UniRef100_F3GSM4 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   124    6e-26 
  UniRef100_A4XRF0 Integral membrane sensor signal transduction h...   124    6e-26 
  UniRef100_N8X412 Uncharacterized protein n=1 Tax=Acinetobacter ...   124    6e-26 
  UniRef100_N9S2W7 Uncharacterized protein n=3 Tax=Acinetobacter ...   124    6e-26 
  UniRef100_J3ECI5 Signal transduction histidine kinase n=1 Tax=P...   124    6e-26 
  UniRef100_V9T2Z0 Sensor histidine kinase n=9 Tax=Pseudomonas ae...   124    6e-26 
  UniRef100_A6V2N3 Probable two-component sensor n=1 Tax=Pseudomo...   124    6e-26 
  UniRef100_M1K6Y2 Sensor protein RstB n=1 Tax=Citrobacter amalon...   124    6e-26 
  UniRef100_U5R4Y8 HAMP domain protein n=3 Tax=Pseudomonas aerugi...   124    6e-26 
  UniRef100_L7HHR8 Sensor histidine kinase n=1 Tax=Pseudomonas fl...   124    6e-26 
  UniRef100_E9Z767 Hsp90-like protein n=1 Tax=Escherichia ferguso...   124    6e-26 
  UniRef100_UPI000288FA90 sensor histidine kinase n=1 Tax=Pseudom...   124    6e-26 
  UniRef100_UPI000237D48D sensor protein RstB n=1 Tax=Enterobacte...   124    6e-26 
  UniRef100_S9QCA0 Sensor histidine kinase n=1 Tax=Thalassobacter...   124    6e-26 
  UniRef100_A4C518 Sensor protein RstB n=1 Tax=Pseudoalteromonas ...   124    6e-26 
  UniRef100_UPI0003B3A468 signal protein n=1 Tax=Sphingomonas phy...   124    6e-26 
  UniRef100_Q0B6R0 Periplasmic sensor signal transduction histidi...   124    6e-26 
  UniRef100_N2CRW3 Uncharacterized protein n=7 Tax=Pseudomonas Re...   124    6e-26 
  UniRef100_J2TAY5 Signal transduction histidine kinase n=1 Tax=P...   124    6e-26 
  UniRef100_C4K291 Osmolarity sensor protein envZ n=1 Tax=Rickett...   124    6e-26 
  UniRef100_R4RB41 Sensor histidine kinase n=2 Tax=Pseudomonas pr...   124    6e-26 
  UniRef100_S6J3U7 Putative two component system, sensor kinase n...   124    6e-26 
  UniRef100_M1IW56 Sensor protein RstB n=4 Tax=Cronobacter sakaza...   124    6e-26 
  UniRef100_I4L9L0 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   124    6e-26 
  UniRef100_W4NQQ4 Sensor histidine kinase n=1 Tax=Burkholderia c...   124    6e-26 
  UniRef100_B4WBQ9 ATPase, histidine kinase-, DNA gyrase B-, and ...   124    6e-26 
  UniRef100_K5XAQ0 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   124    6e-26 
  UniRef100_UPI00030DAF9E hypothetical protein n=1 Tax=Pseudomona...   124    6e-26 
  UniRef100_D0L1R4 Integral membrane sensor signal transduction h...   124    6e-26 
  UniRef100_W2FIE6 Sensor histidine kinase n=2 Tax=Pseudomonas Re...   124    6e-26 
  UniRef100_Q887K1 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   124    7e-26 
  UniRef100_Q4K7T0 Sensor histidine kinase n=1 Tax=Pseudomonas fl...   124    7e-26 
  UniRef100_Q5GVZ2 Signal transduction histidine kinase n=3 Tax=X...   124    7e-26 
  UniRef100_UPI00028873AF histidine kinase n=1 Tax=Acinetobacter ...   124    7e-26 
  UniRef100_X6GIQ4 Histidine kinase n=1 Tax=Mesorhizobium sp. L48...   124    7e-26 
  UniRef100_N1NJ48 Sensory histidine kinase in two-component regu...   124    7e-26 
  UniRef100_UPI00029A8326 sensor histidine kinase n=1 Tax=Pseudom...   124    7e-26 
  UniRef100_B4EIL7 Two-component regulatory system, sensor kinase...   124    7e-26 
  UniRef100_V6J9W5 HAMP domain protein n=1 Tax=Pseudomonas putida...   124    7e-26 
  UniRef100_K8A5C4 Sensory histidine kinase in two-component regu...   124    7e-26 
  UniRef100_J3DYX9 Signal transduction histidine kinase n=1 Tax=P...   124    7e-26 
  UniRef100_J2LDA4 Signal transduction histidine kinase n=1 Tax=P...   124    7e-26 
  UniRef100_UPI00036B03DB histidine kinase n=1 Tax=Acinetobacter ...   124    7e-26 
  UniRef100_UPI00035F7D97 ATPase n=1 Tax=Burkholderia bryophila R...   124    7e-26 
  UniRef100_N9D824 Uncharacterized protein n=1 Tax=Acinetobacter ...   124    7e-26 
  UniRef100_UPI0002DDC1EB sensor histidine kinase n=1 Tax=Pseudom...   124    7e-26 
  UniRef100_J2RZK2 Signal transduction histidine kinase n=1 Tax=P...   124    7e-26 
  UniRef100_I2BWW3 Sensor histidine kinase n=1 Tax=Pseudomonas fl...   124    7e-26 
  UniRef100_W7QK96 Histidine kinase n=1 Tax=Halomonas sp. BC04 Re...   124    7e-26 
  UniRef100_K1BVE8 Two-component sensor n=1 Tax=Pseudomonas aerug...   124    7e-26 
  UniRef100_R8XZU0 Uncharacterized protein n=1 Tax=Acinetobacter ...   124    7e-26 
  UniRef100_J3BFT5 Signal transduction histidine kinase n=1 Tax=P...   124    7e-26 
  UniRef100_Q88P40 Sensor histidine kinase n=1 Tax=Pseudomonas pu...   124    7e-26 
  UniRef100_U9ASK1 Two-component system sensor n=1 Tax=Pseudomona...   124    7e-26 
  UniRef100_A0B2W1 Periplasmic sensor signal transduction histidi...   124    7e-26 
  UniRef100_N9EXB7 Uncharacterized protein n=1 Tax=Acinetobacter ...   124    7e-26 
  UniRef100_J2U5Z2 Signal transduction histidine kinase n=1 Tax=P...   124    7e-26 
  UniRef100_N9W3C9 Integral membrane sensor signal transduction n...   124    7e-26 
  UniRef100_A6T3B8 Two-component sensor histidine kinase n=1 Tax=...   124    7e-26 
  UniRef100_Q6LGY4 Putative sensor histidine kinase n=1 Tax=Photo...   124    8e-26 
  UniRef100_K9NGM6 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   124    8e-26 
  UniRef100_J3GGM1 Signal transduction histidine kinase n=1 Tax=P...   124    8e-26 
  UniRef100_L0GMJ7 Signal transduction histidine kinase n=1 Tax=P...   124    8e-26 
  UniRef100_I7B8W9 Integral membrane sensor signal transduction n...   124    8e-26 
  UniRef100_U9IXE4 Two-component system sensor n=2 Tax=Pseudomona...   124    8e-26 
  UniRef100_J7JB88 Integral membrane sensor signal transduction h...   124    8e-26 
  UniRef100_Y1KED2 Sensor protein CpxA n=1 Tax=Enterobacter sp. M...   124    8e-26 
  UniRef100_V8AAM4 Sensor histidine kinase n=1 Tax=Asaia sp. SF2....   124    8e-26 
  UniRef100_R8ZA05 Putative two-component sensor n=1 Tax=Pseudomo...   124    8e-26 
  UniRef100_N6Y744 Putative sensor histidine kinase n=1 Tax=Thaue...   124    8e-26 
  UniRef100_M7R0J5 Integral membrane sensor signal transduction n...   124    8e-26 
  UniRef100_J8TD86 Sensor protein RstB n=1 Tax=Pectobacterium was...   124    8e-26 
  UniRef100_V9U301 Integral membrane sensor signal transduction h...   124    8e-26 
  UniRef100_UPI000366BE51 hypothetical protein n=1 Tax=Curvibacte...   124    8e-26 
  UniRef100_X7DTL4 Two-component system sensor n=1 Tax=Pseudomona...   124    8e-26 
  UniRef100_W6WPG2 Integral membrane sensor signal transduction h...   124    8e-26 
  UniRef100_J2MKH0 Signal transduction histidine kinase n=2 Tax=P...   124    8e-26 
  UniRef100_I2DS70 Integral membrane sensor signal transduction h...   124    8e-26 
  UniRef100_W1LAV2 Sensor histidine kinase n=1 Tax=Agrobacterium ...   124    8e-26 
  UniRef100_J7A5J2 Two-component sensor n=2 Tax=Pseudomonas aerug...   124    8e-26 
  UniRef100_A4ZV26 RsrS n=1 Tax=Acidithiobacillus caldus RepID=A4...   124    8e-26 
  UniRef100_UPI00034B8872 hypothetical protein n=1 Tax=Burkholder...   124    8e-26 
  UniRef100_I2BEF6 Sensor protein CpxA n=1 Tax=Shimwellia blattae...   124    8e-26 
  UniRef100_W6W6N0 Integral membrane sensor signal transduction h...   124    8e-26 
  UniRef100_H7ESU1 Sensor histidine kinase n=1 Tax=Pseudomonas st...   124    8e-26 
  UniRef100_A3KWL3 Putative uncharacterized protein n=2 Tax=Pseud...   124    8e-26 
  UniRef100_W0QFN4 Sensor kinase n=1 Tax=Mannheimia varigena USDA...   124    9e-26 
  UniRef100_M8BBA5 Integral membrane sensor signal transduction h...   124    9e-26 
  UniRef100_J3AQE1 Signal transduction histidine kinase n=1 Tax=P...   124    9e-26 
  UniRef100_G9Z7S8 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   124    9e-26 
  UniRef100_K2J0J6 Integral membrane sensor signal transduction h...   124    9e-26 
  UniRef100_K1CVR7 Two-component sensor n=8 Tax=Pseudomonas aerug...   124    9e-26 
  UniRef100_C6NYW7 Integral membrane sensor signal transduction h...   124    9e-26 
  UniRef100_B1FCD6 Integral membrane sensor signal transduction h...   124    9e-26 
  UniRef100_R9ZHL9 Sensor histidine kinase n=11 Tax=Pseudomonas a...   124    9e-26 
  UniRef100_Q1BX76 Periplasmic sensor signal transduction histidi...   124    9e-26 
  UniRef100_J2WL12 Signal transduction histidine kinase n=1 Tax=P...   124    9e-26 
  UniRef100_E4R6F2 Integral membrane sensor signal transduction h...   124    9e-26 
  UniRef100_L2FA34 Integral membrane sensor signal transduction h...   124    9e-26 
  UniRef100_A7MMN7 Uncharacterized protein n=1 Tax=Cronobacter sa...   124    9e-26 
  UniRef100_M5FG59 Putative Sensor protein n=1 Tax=Mesorhizobium ...   124    9e-26 
  UniRef100_A7IKU0 Integral membrane sensor signal transduction h...   124    1e-25 
  UniRef100_V4NG09 Uncharacterized protein n=1 Tax=Asticcacaulis ...   124    1e-25 
  UniRef100_B1Z0N5 Integral membrane sensor signal transduction h...   124    1e-25 
  UniRef100_W5IVZ6 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   124    1e-25 
  UniRef100_W0YTI9 Putative two-component sensor n=2 Tax=Pseudomo...   124    1e-25 
  UniRef100_J2NX54 Signal transduction histidine kinase n=1 Tax=P...   124    1e-25 
  UniRef100_U6AAQ8 Integral membrane sensor signal transduction h...   124    1e-25 
  UniRef100_UPI00037812DF ATPase n=1 Tax=Pseudomonas pyrrocinia R...   124    1e-25 
  UniRef100_E1V999 Integral membrane sensor signal transduction h...   124    1e-25 
  UniRef100_W5IYP9 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   124    1e-25 
  UniRef100_J3HIQ9 Signal transduction histidine kinase n=1 Tax=P...   124    1e-25 
  UniRef100_V4GCF9 Sensor histidine kinase n=1 Tax=Pseudomonas pu...   124    1e-25 
  UniRef100_S5EQ25 Histidine kinase n=1 Tax=Serratia liquefaciens...   124    1e-25 
  UniRef100_T5L4T8 Sensor histidine kinase n=11 Tax=Pseudomonas a...   124    1e-25 
  UniRef100_A0A023D332 Two component sensor histidine kinase EnvZ...   124    1e-25 
  UniRef100_U3CCN0 Putative two-component histidine kinase n=1 Ta...   124    1e-25 
  UniRef100_X6ZEZ0 Two-component system sensor n=1 Tax=Pseudomona...   124    1e-25 
  UniRef100_V8DLG7 Histidine kinase n=1 Tax=Pseudomonas chlororap...   124    1e-25 
  UniRef100_A4JJP9 Integral membrane sensor signal transduction h...   124    1e-25 
  UniRef100_B6BCW1 Periplasmic sensor signal transduction histidi...   124    1e-25 
  UniRef100_UPI00036DB0B0 hypothetical protein n=1 Tax=Sinorhizob...   124    1e-25 
  UniRef100_E6PLW9 Putative two-component sensor histidine kinase...   124    1e-25 
  UniRef100_U2Z5X8 Sensor histidine kinase n=1 Tax=Loktanella cin...   124    1e-25 
  UniRef100_E1SE37 Two component sensor kinase n=1 Tax=Pantoea va...   124    1e-25 
  UniRef100_U4VLM1 Sensor protein RstB n=1 Tax=Pantoea agglomeran...   124    1e-25 
  UniRef100_A0A013SWM4 HAMP domain protein n=2 Tax=Acinetobacter ...   124    1e-25 
  UniRef100_W6UUG8 Integral membrane sensor signal transduction h...   124    1e-25 
  UniRef100_J3CB65 Signal transduction histidine kinase n=1 Tax=P...   124    1e-25 
  UniRef100_UPI00035C7512 hypothetical protein n=1 Tax=Halomonas ...   124    1e-25 
  UniRef100_F2I0J5 Osmolarity sensor protein EnvZ n=1 Tax=Pelagib...   124    1e-25 
  UniRef100_V4R834 Sensor histidine kinase n=1 Tax=Pseudomonas ae...   124    1e-25 
  UniRef100_N2IYA7 Uncharacterized protein n=1 Tax=Pseudomonas sp...   124    1e-25 
  UniRef100_J2XST8 Signal transduction histidine kinase n=1 Tax=P...   124    1e-25 
  UniRef100_UPI00037BDA9A histidine kinase, partial n=1 Tax=Sphin...   124    1e-25 
  UniRef100_A6T322 Two component sensor histidine kinase protein ...   124    1e-25 
  UniRef100_V8G9U3 Sensor histidine kinase n=1 Tax=Pseudomonas ae...   124    1e-25 
  UniRef100_Q0FGC3 Signal transduction kinase protein n=1 Tax=Rho...   124    1e-25 
  UniRef100_K4FIX1 Sensor protein RstB n=1 Tax=Pectobacterium sp....   124    1e-25 
  UniRef100_C4S0B8 Putative uncharacterized protein n=1 Tax=Yersi...   124    1e-25 
  UniRef100_UPI0002624EDC integral membrane sensor signal transdu...   124    1e-25 
  UniRef100_UPI00034C1B65 hypothetical protein n=1 Tax=Ideonella ...   124    1e-25 
  UniRef100_A5V889 Integral membrane sensor signal transduction h...   124    1e-25 
  UniRef100_UPI0003701275 sensor histidine kinase n=1 Tax=Pseudom...   124    1e-25 
  UniRef100_V5F4C3 Two-component histidine kinase CpxA n=1 Tax=Vi...   124    1e-25 
  UniRef100_D0GQ10 Sensor protein CpxA n=1 Tax=Vibrio mimicus MB4...   124    1e-25 
  UniRef100_UPI0003A725F4 two-component sensor protein n=1 Tax=Sa...   124    1e-25 
  UniRef100_UPI0003B73074 histidine kinase n=1 Tax=Psychromonas h...   124    1e-25 
  UniRef100_UPI0002F43C85 histidine kinase n=1 Tax=Pseudomonas ch...   124    1e-25 
  UniRef100_UPI0003700575 sensor histidine kinase, partial n=1 Ta...   124    1e-25 
  UniRef100_J2Y828 Signal transduction histidine kinase n=1 Tax=P...   124    1e-25 
  UniRef100_I3CLH9 Sensor histidine kinase n=1 Tax=Herbaspirillum...   124    1e-25 
  UniRef100_Q3K7Z5 Putative two-component sensor histidine kinase...   123    1e-25 
  UniRef100_UPI0002D72DD5 sensor histidine kinase n=1 Tax=Pseudom...   123    1e-25 
  UniRef100_D5WLN9 Integral membrane sensor signal transduction h...   123    1e-25 
  UniRef100_V7DZZ7 Signal transduction histidine kinase n=2 Tax=P...   123    1e-25 
  UniRef100_E8M8H3 Signal transduction histidine kinase n=1 Tax=V...   123    1e-25 
  UniRef100_E6WCU0 Integral membrane sensor signal transduction h...   123    1e-25 
  UniRef100_K8REH2 Integral membrane sensor signal transduction h...   123    1e-25 
  UniRef100_C2GIK4 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   123    1e-25 
  UniRef100_UPI000287B30C sensor histidine kinase n=1 Tax=Pseudom...   123    1e-25 
  UniRef100_U8D7F4 Two-component system sensor n=1 Tax=Pseudomona...   123    1e-25 
  UniRef100_U2P0R7 Sensory histidine kinase in two-component regu...   123    1e-25 
  UniRef100_UPI0003956F58 sensor histidine kinase n=1 Tax=Saliniv...   123    1e-25 
  UniRef100_UPI00036D2A86 MULTISPECIES: sensor histidine kinase n...   123    1e-25 
  UniRef100_UPI00029A15A2 ATPase n=1 Tax=Pseudomonas mandelii Rep...   123    1e-25 
  UniRef100_UPI000299FF5E sensor histidine kinase n=1 Tax=Pseudom...   123    1e-25 
  UniRef100_UPI0001CBF4F4 histidine kinase n=1 Tax=Xanthomonas va...   123    1e-25 
  UniRef100_B7LQQ5 Sensory histidine kinase in two-component regu...   123    1e-25 
  UniRef100_K9NQ67 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   123    1e-25 
  UniRef100_UPI0003788814 histidine kinase n=1 Tax=Serratia sp. S...   123    2e-25 
  UniRef100_UPI00036CC25B histidine kinase n=1 Tax=Pseudomonas fl...   123    2e-25 
  UniRef100_UPI000363C1F9 ATPase n=1 Tax=Burkholderia sp. JPY251 ...   123    2e-25 
  UniRef100_D0KFS1 Integral membrane sensor signal transduction h...   123    2e-25 
  UniRef100_L0MI73 Signal transduction histidine kinase n=1 Tax=S...   123    2e-25 
  UniRef100_J3FHF7 Signal transduction histidine kinase n=1 Tax=P...   123    2e-25 
  UniRef100_J4QYP4 HAMP domain-containing protein 11 n=1 Tax=Achr...   123    2e-25 
  UniRef100_J2MYT8 Signal transduction histidine kinase n=1 Tax=P...   123    2e-25 
  UniRef100_A0A021W1G6 Uncharacterized protein n=1 Tax=Lysobacter...   123    2e-25 
  UniRef100_UPI00029AFE7E sensor histidine kinase n=1 Tax=Pseudom...   123    2e-25 
  UniRef100_D8IWX6 Sensor histidine kinase protein n=1 Tax=Herbas...   123    2e-25 
  UniRef100_L1M2U6 Putative two-component sensor histidine kinase...   123    2e-25 
  UniRef100_D4B9V7 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   123    2e-25 
  UniRef100_T2EM91 HAMP domain protein n=1 Tax=Pseudomonas aerugi...   123    2e-25 
  UniRef100_D4E635 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   123    2e-25 
  UniRef100_T0IXL8 Histidine kinase n=1 Tax=Sphingobium lactosute...   123    2e-25 
  UniRef100_UPI000365E53B hypothetical protein n=1 Tax=alpha prot...   123    2e-25 
  UniRef100_K8AUY1 Sensory histidine kinase in two-component regu...   123    2e-25 
  UniRef100_J3H6X0 Signal transduction histidine kinase n=1 Tax=P...   123    2e-25 
  UniRef100_J2MJP1 Signal transduction histidine kinase n=2 Tax=P...   123    2e-25 
  UniRef100_W6VP82 Integral membrane sensor signal transduction h...   123    2e-25 
  UniRef100_A0A013XVH7 Histidine kinase n=1 Tax=Sphingobium sp. A...   123    2e-25 
  UniRef100_UPI0001A42AF0 sensor protein RstB n=1 Tax=Pectobacter...   123    2e-25 
  UniRef100_B2T6Z3 Integral membrane sensor signal transduction h...   123    2e-25 
  UniRef100_K8BHH1 Sensory histidine kinase in two-component regu...   123    2e-25 
  UniRef100_A3QF25 Integral membrane sensor signal transduction h...   123    2e-25 
  UniRef100_J2F0L4 Sensor histidine kinase n=1 Tax=Pseudomonas fl...   123    2e-25 
  UniRef100_G0GY25 Osmolarity sensor protein EnvZ n=1 Tax=Rickett...   123    2e-25 
  UniRef100_M4U708 Uncharacterized protein n=1 Tax=Psychromonas s...   123    2e-25 
  UniRef100_H8KA15 Osmolarity sensor protein EnvZ n=1 Tax=Rickett...   123    2e-25 
  UniRef100_B4WXX6 ATPase, histidine kinase-, DNA gyrase B-, and ...   123    2e-25 
  UniRef100_L9PDN7 Two-component signal transduction histidine ki...   123    2e-25 
  UniRef100_H8DJM1 Sensor protein RstB n=1 Tax=Pantoea sp. Sc1 Re...   123    2e-25 
  UniRef100_J2XY11 Sensor histidine kinase n=1 Tax=Pseudomonas ch...   123    2e-25 
  UniRef100_U1X454 Osmolarity sensor protein EnvZ n=1 Tax=Ochroba...   123    2e-25 
  UniRef100_S2FW48 Signal transduction histidine kinase n=1 Tax=P...   123    2e-25 
  UniRef100_UPI00037583B7 hypothetical protein n=1 Tax=Duganella ...   123    2e-25 
  UniRef100_U8GAC1 Two-component system sensor n=2 Tax=Pseudomona...   123    2e-25 
  UniRef100_UPI00036669A2 histidine kinase n=1 Tax=Herbaspirillum...   123    2e-25 
  UniRef100_I0QQW3 Two-component sensor protein n=1 Tax=Serratia ...   123    2e-25 
  UniRef100_G4KN13 Osmolarity sensor protein envZ n=1 Tax=Rickett...   123    2e-25 
  UniRef100_D3NY20 Two-component sensor histidine kinase n=1 Tax=...   123    2e-25 
  UniRef100_H6PTN0 Osmolarity sensor protein EnvZ n=1 Tax=Rickett...   123    2e-25 
  UniRef100_A0A023CAB3 Histidine kinase n=1 Tax=Pseudomonas extre...   123    2e-25 
  UniRef100_UPI000346E40C histidine kinase n=1 Tax=Burkholderia k...   123    2e-25 
  UniRef100_E3HGZ3 HAMP domain protein 12 n=1 Tax=Achromobacter x...   123    2e-25 
  UniRef100_UPI00035F170F sensor histidine kinase n=1 Tax=Pseudom...   123    2e-25 
  UniRef100_UPI0003B50CF5 histidine kinase n=1 Tax=Spongiibacter ...   123    2e-25 
  UniRef100_E6W8C4 Integral membrane sensor signal transduction h...   123    2e-25 
  UniRef100_R8ALS8 Two-component sensor protein n=1 Tax=Plesiomon...   123    2e-25 
  UniRef100_K2IEU1 Sensor histidine kinase n=1 Tax=Aeromonas medi...   123    2e-25 
  UniRef100_J2RN91 Signal transduction histidine kinase n=1 Tax=P...   123    2e-25 
  UniRef100_UPI000376FFBF histidine kinase n=1 Tax=Moraxella boev...   123    2e-25 
  UniRef100_E3G6R9 Integral membrane sensor signal transduction h...   123    2e-25 
  UniRef100_W4HGT5 Integral membrane sensor signal transduction h...   123    2e-25 
  UniRef100_T2HB56 Putative two-component histidine kinase n=1 Ta...   123    2e-25 
  UniRef100_UPI0002D99806 histidine kinase n=1 Tax=Xanthomonas or...   123    2e-25 
  UniRef100_W6QTY8 Periplasmic sensor Signal transduction histidi...   123    2e-25 
  UniRef100_I2EJ37 Sensor protein RstB n=1 Tax=Cronobacter sakaza...   123    2e-25 
  UniRef100_G7Z230 Putative signal transduction histidine kinase ...   123    2e-25 
  UniRef100_UPI0002FBCE16 sensor histidine kinase n=1 Tax=Pseudom...   123    2e-25 
  UniRef100_UPI0002DAD798 histidine kinase n=1 Tax=Pseudomonas fl...   123    2e-25 
  UniRef100_UPI000319F2AF histidine kinase n=1 Tax=Xanthomonas or...   122    2e-25 
  UniRef100_UPI000375115B ATPase n=1 Tax=Rickettsia conorii RepID...   122    2e-25 
  UniRef100_UPI0002F0D07F sensor histidine kinase n=1 Tax=Pseudom...   122    2e-25 
  UniRef100_UPI0002E5EA5A sensor histidine kinase n=2 Tax=Pseudom...   122    2e-25 
  UniRef100_UPI0002D3346E histidine kinase n=1 Tax=Pseudomonas sp...   122    2e-25 
  UniRef100_W2DUE6 Putative two-component sensor histidine kinase...   122    2e-25 
  UniRef100_K8DB84 Sensory histidine kinase in two-component regu...   122    2e-25 
  UniRef100_Q6D5M9 Two component sensor kinase n=1 Tax=Pectobacte...   122    2e-25 
  UniRef100_UPI00029B220E transcriptional regulator n=1 Tax=Pseud...   122    2e-25 
  UniRef100_A1W2H3 Integral membrane sensor signal transduction h...   122    2e-25 
  UniRef100_K8AI92 Sensory histidine kinase in two-component regu...   122    2e-25 
  UniRef100_UPI00031515ED sensor histidine kinase n=1 Tax=Pseudom...   122    2e-25 
  UniRef100_H8KDK4 Osmolarity sensor protein EnvZ n=1 Tax=Rickett...   122    2e-25 
  UniRef100_C3PNF2 Osmolarity sensor protein EnvZ n=1 Tax=Rickett...   122    2e-25 
  UniRef100_S6HGQ6 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   122    2e-25 
  UniRef100_UPI0002556EC7 sensor histidine kinase n=1 Tax=Pseudom...   122    2e-25 
  UniRef100_H0JG63 Periplasmic sensor Signal transduction histidi...   122    2e-25 
  UniRef100_UPI0002D2CF77 sensor histidine kinase n=1 Tax=Pseudom...   122    2e-25 
  UniRef100_UPI00038078DB hypothetical protein n=1 Tax=Halomonas ...   122    2e-25 
  UniRef100_UPI00035F8706 ATPase n=1 Tax=Rickettsia conorii RepID...   122    2e-25 
  UniRef100_Q4K871 Sensor histidine kinase n=2 Tax=Pseudomonas pr...   122    2e-25 
  UniRef100_C0VSZ5 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   122    2e-25 
  UniRef100_F7UF73 Integral membrane sensor signal transduction h...   122    3e-25 
  UniRef100_UPI0003725E8F hypothetical protein n=1 Tax=Oxalobacte...   122    3e-25 
  UniRef100_Q7PBV0 Osmolarity sensor protein envZ n=1 Tax=Rickett...   122    3e-25 
  UniRef100_L0VSZ4 Two-component sensor kinase n=1 Tax=Serratia p...   122    3e-25 
  UniRef100_G8LAJ5 Osmolarity sensor protein EnvZ n=10 Tax=spotte...   122    3e-25 
  UniRef100_M4ZMU0 Putative two-component sensor histidine kinase...   122    3e-25 
  UniRef100_V4P1K2 Uncharacterized protein n=1 Tax=Asticcacaulis ...   122    3e-25 
  UniRef100_C4ZLU8 Histidine kinase n=2 Tax=Thauera RepID=C4ZLU8_...   122    3e-25 
  UniRef100_UPI0002E799FB sensor histidine kinase n=1 Tax=Pseudom...   122    3e-25 
  UniRef100_L0MPI8 Signal transduction histidine kinase n=1 Tax=S...   122    3e-25 
  UniRef100_UPI00030E0EC5 sensor histidine kinase n=1 Tax=Pseudom...   122    3e-25 
  UniRef100_G8Q9J9 Integral membrane sensor signal transduction h...   122    3e-25 
  UniRef100_S2F5R4 Signal transduction histidine kinase n=1 Tax=P...   122    3e-25 
  UniRef100_V8DCM7 Sensor histidine kinase n=1 Tax=Pseudomonas ch...   122    3e-25 
  UniRef100_U1U362 Sensor histidine kinase n=1 Tax=Pseudomonas me...   122    3e-25 
  UniRef100_UPI000364C6F2 transcriptional regulator n=1 Tax=Steno...   122    3e-25 
  UniRef100_I1ALL1 Two-component sensor n=2 Tax=Pseudomonas aerug...   122    3e-25 
  UniRef100_I4L054 Sensor histidine kinase n=2 Tax=Pseudomonas Re...   122    3e-25 
  UniRef100_U2G044 Integral membrane sensor signal transduction h...   122    3e-25 
  UniRef100_R6T795 Uncharacterized protein n=3 Tax=Dorea RepID=R6...   122    3e-25 
  UniRef100_UPI0002EB9E19 sensor histidine kinase n=1 Tax=Pseudom...   122    3e-25 
  UniRef100_U8HHW8 Two-component system sensor n=5 Tax=Pseudomona...   122    3e-25 
  UniRef100_U4ZFR2 Histidine kinase n=4 Tax=Vibrio mimicus RepID=...   122    3e-25 
  UniRef100_H3MWB2 Sensor protein rstB n=1 Tax=Klebsiella oxytoca...   122    3e-25 
  UniRef100_V6UQ24 Histidine kinase n=1 Tax=Pseudomonas mosselii ...   122    3e-25 
  UniRef100_A0A010RZX9 Sensor histidine kinase n=1 Tax=Pseudomona...   122    3e-25 
  UniRef100_UPI00028988C3 sensor histidine kinase n=1 Tax=Pseudom...   122    3e-25 
  UniRef100_J3GMN1 Signal transduction histidine kinase n=1 Tax=P...   122    3e-25 
  UniRef100_J3APR9 Signal transduction histidine kinase n=1 Tax=C...   122    3e-25 
  UniRef100_UPI0002DD40F4 histidine kinase n=1 Tax=Vibrio genomos...   122    3e-25 
  UniRef100_M5NBF2 Copper sensory histidine kinase CpxA n=1 Tax=V...   122    3e-25 
  UniRef100_W8PSJ8 Histidine kinase n=1 Tax=Pseudomonas brassicac...   122    3e-25 
  UniRef100_Q0IAT0 Two-component sensor histidine kinase n=1 Tax=...   122    3e-25 
  UniRef100_S0IBX6 Two-component system sensor n=5 Tax=Pseudomona...   122    3e-25 
  UniRef100_S6I8N8 Periplasmic sensor Signal transduction histidi...   122    3e-25 
  UniRef100_F6CUC3 Integral membrane sensor signal transduction h...   122    3e-25 
  UniRef100_K6YA03 Two-component system, OmpR family, sensor kina...   122    3e-25 
  UniRef100_J3D953 Signal transduction histidine kinase n=1 Tax=P...   122    3e-25 
  UniRef100_H0F1H3 HAMP domain-containing protein 3 n=1 Tax=Achro...   122    3e-25 
  UniRef100_E8TE47 ATP-binding region ATPase domain protein n=1 T...   122    3e-25 
  UniRef100_C3K174 Putative two-component sensor histidine kinase...   122    3e-25 
  UniRef100_G8PWC4 Integral membrane sensor signal transduction h...   122    3e-25 
  UniRef100_G8M691 Integral membrane sensor signal transduction h...   122    3e-25 
  UniRef100_UPI00029A0E01 histidine kinase n=1 Tax=Pseudomonas ma...   122    3e-25 
  UniRef100_UPI0002488F79 two component sensor histidine kinase n...   122    3e-25 
  UniRef100_A0A011LXM4 Histidine kinase n=1 Tax=Mannheimia haemol...   122    3e-25 
  UniRef100_J3IMY5 Signal transduction histidine kinase n=1 Tax=P...   122    3e-25 
  UniRef100_UPI0003625223 MULTISPECIES: ATPase n=1 Tax=Pseudomona...   122    3e-25 
  UniRef100_F1YTR8 Osmolarity sensor protein EnvZ n=1 Tax=Acetoba...   122    3e-25 
  UniRef100_UPI0002FEE329 sensor histidine kinase n=1 Tax=Pseudom...   122    3e-25 
  UniRef100_W6WCR3 Integral membrane sensor signal transduction h...   122    3e-25 
  UniRef100_UPI0003756B60 ATPase n=1 Tax=Rickettsia honei RepID=U...   122    3e-25 
  UniRef100_UPI00036A1D28 hypothetical protein n=1 Tax=Sphingomon...   122    3e-25 
  UniRef100_B1T269 Integral membrane sensor signal transduction h...   122    3e-25 
  UniRef100_A4W9Y9 Integral membrane sensor signal transduction h...   122    3e-25 
  UniRef100_W7FVW9 ATPase n=1 Tax=Stenotrophomonas maltophilia 5B...   122    3e-25 
  UniRef100_B0KRC8 Integral membrane sensor signal transduction h...   122    4e-25 
  UniRef100_R9V3G4 Sensor histidine kinase n=2 Tax=Pseudomonas pu...   122    4e-25 
  UniRef100_K0WJD3 Signal transduction histidine kinase n=1 Tax=P...   122    4e-25 
  UniRef100_H8K598 Osmolarity sensor protein EnvZ n=1 Tax=Rickett...   122    4e-25 
  UniRef100_UPI00039555A6 histidine kinase n=1 Tax=Comamonas sp. ...   122    4e-25 
  UniRef100_V7E3G9 Signal transduction histidine kinase n=2 Tax=P...   122    4e-25 
  UniRef100_U8UC24 Two-component system sensor n=1 Tax=Pseudomona...   122    4e-25 
  UniRef100_A0A010SDT9 Histidine kinase n=1 Tax=Pseudomonas fluor...   122    4e-25 
  UniRef100_UPI0003635015 hypothetical protein n=1 Tax=Endozoicom...   122    4e-25 
  UniRef100_E1W453 Sensory histidine kinase in two-component regu...   122    4e-25 
  UniRef100_W0QEG0 Sensor kinase n=2 Tax=Mannheimia varigena RepI...   122    4e-25 
  UniRef100_A0Y4L3 Sensory histidine kinase in two-component regu...   122    4e-25 
  UniRef100_UPI00029B44E0 sensor histidine kinase n=1 Tax=Pseudom...   122    4e-25 
  UniRef100_UPI0003686016 ATPase n=1 Tax=Pseudomonas mandelii Rep...   122    4e-25 
  UniRef100_F3D8U1 Sensor histidine kinase n=2 Tax=Pseudomonas am...   122    4e-25 
  UniRef100_J3GM91 Signal transduction histidine kinase n=1 Tax=P...   122    4e-25 
  UniRef100_D0HIU4 Sensor protein CpxA n=1 Tax=Vibrio mimicus VM2...   122    4e-25 
  UniRef100_A0A022M2Q6 ATPase n=1 Tax=Stenotrophomonas maltophili...   122    4e-25 
  UniRef100_UPI000382009D hypothetical protein n=1 Tax=Marinobact...   122    4e-25 
  UniRef100_B1KBH9 Histidine kinase n=1 Tax=Burkholderia cenocepa...   122    4e-25 
  UniRef100_W6VNT4 Integral membrane sensor signal transduction h...   122    4e-25 
  UniRef100_UPI000362EB55 ATPase n=1 Tax=Rickettsia sibirica RepI...   122    4e-25 
  UniRef100_UPI000371F867 ATPase n=1 Tax=Rhizobium sp. 2MFCol3.1 ...   122    4e-25 
  UniRef100_J2EZI3 Sensor histidine kinase n=1 Tax=Pseudomonas fl...   122    4e-25 
  UniRef100_J2ZU28 Signal transduction histidine kinase n=1 Tax=P...   122    4e-25 
  UniRef100_X6H3K9 ATPase n=1 Tax=Mesorhizobium sp. L2C084A000 Re...   122    4e-25 
  UniRef100_A5WBW6 Integral membrane sensor signal transduction h...   122    4e-25 
  UniRef100_M1NXY2 Sensor histidine kinase EnvZ n=2 Tax=Bartonell...   122    4e-25 
  UniRef100_J2UKK7 Signal transduction histidine kinase n=1 Tax=P...   122    4e-25 
  UniRef100_UPI00031DFEC3 sensor histidine kinase n=1 Tax=Pseudom...   122    4e-25 
  UniRef100_G7TD49 Two-component system sensor protein n=1 Tax=Xa...   122    4e-25 
  UniRef100_U1TPV5 Sensor histidine kinase n=1 Tax=Pseudomonas fl...   122    4e-25 
  UniRef100_I3D6P4 Putative sensor protein CpxA n=1 Tax=Pasteurel...   122    4e-25 
  UniRef100_U7A1B7 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   122    4e-25 
  UniRef100_W0Q345 Sensor kinase n=1 Tax=Mannheimia varigena USDA...   122    4e-25 
  UniRef100_R4WSW0 Integral membrane sensor signal transduction h...   122    4e-25 
  UniRef100_B2JI10 Integral membrane sensor signal transduction h...   122    4e-25 
  UniRef100_Q5GVZ6 Signal transduction histidine kinase n=1 Tax=X...   122    4e-25 
  UniRef100_G8LMA7 Sensor protein rstB n=5 Tax=Enterobacter cloac...   122    4e-25 
  UniRef100_C4WPH4 Uncharacterized protein n=2 Tax=Ochrobactrum i...   122    4e-25 
  UniRef100_S3J7J9 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   122    5e-25 
  UniRef100_K6B7J3 Sensor histidine kinase n=1 Tax=Pseudomonas vi...   122    5e-25 
  UniRef100_C9Q5Z4 Sensor protein CpxA n=1 Tax=Vibrio sp. RC341 R...   122    5e-25 
  UniRef100_V9R4B0 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   122    5e-25 
  UniRef100_E6V7M4 Integral membrane sensor signal transduction h...   122    5e-25 
  UniRef100_H8FQ61 Putative two-component sensor histidine kinase...   122    5e-25 
  UniRef100_UPI0002D63C6C ATPase n=1 Tax=Rickettsia conorii RepID...   122    5e-25 
  UniRef100_C5CXB7 Histidine kinase n=1 Tax=Variovorax paradoxus ...   122    5e-25 
  UniRef100_J2WWU7 Signal transduction histidine kinase n=1 Tax=P...   122    5e-25 
  UniRef100_Q2NZ70 Two-component system sensor protein n=1 Tax=Xa...   122    5e-25 
  UniRef100_K6L7X6 Sensor protein RstB n=1 Tax=Klebsiella oxytoca...   122    5e-25 
  UniRef100_C9P1V6 Signal transduction histidine kinase n=1 Tax=V...   122    5e-25 
  UniRef100_W0BDW6 Signal transduction histidine kinase n=2 Tax=L...   122    5e-25 
  UniRef100_S6J7F2 Putative two-component system sensor kinase n=...   122    5e-25 
  UniRef100_I4XQ45 Sensor histidine kinase n=1 Tax=Pseudomonas ch...   122    5e-25 
  UniRef100_U3GW87 Uncharacterized protein n=1 Tax=Corynebacteriu...   122    5e-25 
  UniRef100_C4TUI4 Signal transduction histidine kinase n=1 Tax=Y...   122    5e-25 
  UniRef100_I4XPB3 Sensor histidine kinase n=1 Tax=Pseudomonas ch...   122    5e-25 
  UniRef100_E2XXG0 Periplasmic sensor signal transduction histidi...   121    5e-25 
  UniRef100_G0E5F5 Sensor protein RstB n=4 Tax=Enterobacter aerog...   121    5e-25 
  UniRef100_B2TD63 Integral membrane sensor signal transduction h...   121    5e-25 
  UniRef100_B2SNT8 Two-component system sensor protein n=1 Tax=Xa...   121    5e-25 
  UniRef100_R8WWX9 Sensor protein rstB n=1 Tax=Citrobacter sp. KT...   121    5e-25 
  UniRef100_U9N4J7 Two-component system sensor n=2 Tax=Pseudomona...   121    5e-25 
  UniRef100_J2V277 Signal transduction histidine kinase n=1 Tax=P...   121    5e-25 
  UniRef100_R0FZ94 Sensor histidine kinase n=1 Tax=Herbaspirillum...   121    5e-25 
  UniRef100_UPI0003743DD7 ATPase n=1 Tax=Pseudomonas sp. 45MFCol3...   121    5e-25 
  UniRef100_X5IUP9 Sensor histidine kinase n=1 Tax=Pseudomonas pr...   121    5e-25 
  UniRef100_D0Z823 Sensor protein n=3 Tax=Edwardsiella tarda RepI...   121    5e-25 
  UniRef100_R8VJ87 Sensor protein rstB n=1 Tax=Citrobacter sp. KT...   121    5e-25 
  UniRef100_M5TIE6 Uncharacterized protein n=1 Tax=Stenotrophomon...   121    5e-25 
  UniRef100_UPI0002FBA1AA sensor histidine kinase n=1 Tax=Pseudom...   121    5e-25 
  UniRef100_D4XCH1 Putative D-tyrosyl-tRNA(Tyr) deacylase n=1 Tax...   121    5e-25 
  UniRef100_W0HBN0 Sensor histidine kinase n=1 Tax=Pseudomonas ci...   121    6e-25 
  UniRef100_J2WNM3 Histidine kinase n=1 Tax=Sphingobium sp. AP49 ...   121    6e-25 
  UniRef100_V5FHF6 Putative two-component histidine kinase n=1 Ta...   121    6e-25 
  UniRef100_G6XSM0 Integral membrane sensor signal transduction h...   121    6e-25 
  UniRef100_UPI00029A5A69 MULTISPECIES: ATPase n=1 Tax=Xanthomona...   121    6e-25 
  UniRef100_A8I978 Transcriptional regulator n=1 Tax=Azorhizobium...   121    6e-25 
  UniRef100_G9EBZ4 Osmolarity sensor protein envZ n=1 Tax=Halomon...   121    6e-25 
  UniRef100_I6SKL8 Putative two-component sensor n=1 Tax=Pseudomo...   121    6e-25 
  UniRef100_UPI00037F3A25 osmolarity sensor protein EnvZ n=1 Tax=...   121    6e-25 
  UniRef100_UPI00037E26EF hypothetical protein n=2 Tax=Caulobacte...   121    6e-25 
  UniRef100_UPI0002FE36B2 hypothetical protein n=1 Tax=Vibrio rum...   121    6e-25 
  UniRef100_F7T7K1 HAMP domain-containing protein 11 n=1 Tax=Achr...   121    6e-25 
  UniRef100_UPI0002EC0594 sensor histidine kinase n=1 Tax=Pseudom...   121    6e-25 
  UniRef100_X6CBA4 Sensor histidine kinase n=1 Tax=Mesorhizobium ...   121    6e-25 
  UniRef100_I4KTK7 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   121    6e-25 
  UniRef100_J3BFM8 Signal transduction histidine kinase n=1 Tax=P...   121    6e-25 
  UniRef100_UPI00036E8A03 histidine kinase n=1 Tax=Stenotrophomon...   121    6e-25 
  UniRef100_Q3K8G9 Putative two-component system, sensor kinase n...   121    6e-25 
  UniRef100_UPI0002E571EC sensor histidine kinase n=1 Tax=Pseudom...   121    6e-25 
  UniRef100_A9MRU9 Uncharacterized protein n=1 Tax=Salmonella ari...   121    6e-25 
  UniRef100_V8R492 Sensor histidine kinase n=1 Tax=Pseudomonas mo...   121    6e-25 
  UniRef100_R8ZJX4 Putative two-component sensor n=1 Tax=Pseudomo...   121    6e-25 
  UniRef100_M2U242 Periplasmic sensor signal transduction histidi...   121    6e-25 
  UniRef100_J3H2A4 Signal transduction histidine kinase n=1 Tax=P...   121    6e-25 
  UniRef100_S9NZX3 Sensor histidine kinase n=1 Tax=Cystobacter fu...   121    7e-25 
  UniRef100_R7BY54 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   121    7e-25 
  UniRef100_U9L0H2 Two-component system sensor n=1 Tax=Pseudomona...   121    7e-25 
  UniRef100_N2C6W6 Uncharacterized protein n=1 Tax=Pseudomonas ae...   121    7e-25 
  UniRef100_UPI00037E2918 hypothetical protein n=1 Tax=Curvibacte...   121    7e-25 
  UniRef100_R4XZE1 Sensory histidine kinase in two-component regu...   121    7e-25 
  UniRef100_V4NPN7 Uncharacterized protein n=1 Tax=Asticcacaulis ...   121    7e-25 
  UniRef100_I0KS10 Uncharacterized protein n=1 Tax=Stenotrophomon...   121    7e-25 
  UniRef100_F0E4B7 Integral membrane sensor signal transduction h...   121    7e-25 
  UniRef100_C5BPU3 Putative integral membrane sensor signal trans...   121    7e-25 
  UniRef100_W2DC01 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   121    7e-25 
  UniRef100_U8AXS6 Two-component system sensor n=1 Tax=Pseudomona...   121    7e-25 
  UniRef100_Z5XY69 Histidine kinase n=1 Tax=Pseudoalteromonas lip...   121    7e-25 
  UniRef100_A5WB95 Histidine kinase n=1 Tax=Pseudomonas putida (s...   121    7e-25 
  UniRef100_V9RWQ4 Periplasmic Sensor Signal Transduction Histidi...   121    7e-25 
  UniRef100_C5BA05 Sensor protein RstB, putative n=1 Tax=Edwardsi...   121    7e-25 
  UniRef100_B9MAQ0 Histidine kinase n=1 Tax=Acidovorax ebreus (st...   121    7e-25 
  UniRef100_J4JA36 GHKL domain protein n=1 Tax=Acinetobacter radi...   121    7e-25 
  UniRef100_U1K1W9 Sensory histidine kinase in two-component regu...   121    7e-25 
  UniRef100_A0A009N7I5 HAMP domain protein n=7 Tax=Acinetobacter ...   121    7e-25 
  UniRef100_V8R8A0 ATPase n=1 Tax=Pseudomonas moraviensis R28-S R...   121    8e-25 
  UniRef100_UPI00036FDC7C hypothetical protein n=1 Tax=Terediniba...   121    8e-25 
  UniRef100_X5EWB6 Two-component sensor, ParS n=5 Tax=Pseudomonas...   121    8e-25 
  UniRef100_C4LD75 Histidine kinase n=1 Tax=Tolumonas auensis (st...   121    8e-25 
  UniRef100_W2EJ88 Histidine kinase n=1 Tax=Microbispora sp. ATCC...   121    8e-25 
  UniRef100_B2SNT3 Two-component system sensor protein n=1 Tax=Xa...   121    8e-25 
  UniRef100_UPI00038189A8 hypothetical protein n=1 Tax=Burkholder...   121    8e-25 
  UniRef100_A3SJC5 Sensor histidine kinase n=1 Tax=Roseovarius nu...   121    8e-25 
  UniRef100_S5MPM7 Sensory histidine kinase in two-component regu...   121    8e-25 
  UniRef100_UPI00037B8DC6 hypothetical protein n=1 Tax=Terediniba...   121    8e-25 
  UniRef100_UPI0003756D97 ATPase, partial n=1 Tax=Herbaspirillum ...   121    8e-25 
  UniRef100_T5K015 Histidine kinase n=1 Tax=Stenotrophomonas malt...   121    8e-25 
  UniRef100_V4WRL9 ATPase n=1 Tax=Pseudomonas aeruginosa VRFPA05 ...   121    8e-25 
  UniRef100_T5KSF7 Histidine kinase n=1 Tax=Stenotrophomonas malt...   121    8e-25 
  UniRef100_W6WL32 Integral membrane sensor signal transduction h...   121    8e-25 
  UniRef100_U8DMM0 Two-component system sensor n=6 Tax=Pseudomona...   121    8e-25 
  UniRef100_Z2DH76 ATPase n=1 Tax=Pseudomonas aeruginosa VRFPA09 ...   120    8e-25 
  UniRef100_J3D3X1 Signal transduction histidine kinase n=1 Tax=P...   120    9e-25 
  UniRef100_S4YYP5 Histidine kinase n=1 Tax=Psychrobacter sp. G R...   120    9e-25 
  UniRef100_F2K302 Integral membrane sensor signal transduction h...   120    9e-25 
  UniRef100_E8TBS0 ATP-binding region ATPase domain protein n=1 T...   120    9e-25 
  UniRef100_UPI0002F285EF histidine kinase n=1 Tax=Pseudoalteromo...   120    9e-25 
  UniRef100_E5U6S1 Uncharacterized protein n=1 Tax=Achromobacter ...   120    9e-25 
  UniRef100_G1XWY2 Integral membrane sensor signal transduction h...   120    9e-25 
  UniRef100_U9LQZ4 Two-component system sensor n=1 Tax=Pseudomona...   120    9e-25 
  UniRef100_Q9I2U4 Two-component sensor, ParS n=7 Tax=Pseudomonas...   120    9e-25 
  UniRef100_U8FNN8 Two-component system sensor n=2 Tax=Pseudomona...   120    9e-25 
  UniRef100_UPI0002DC3892 sensor histidine kinase n=1 Tax=Pseudom...   120    9e-25 
  UniRef100_U8KA30 Two-component system sensor n=1 Tax=Pseudomona...   120    9e-25 
  UniRef100_U3HT33 Sensor histidine kinase n=1 Tax=Pseudomonas st...   120    9e-25 
  UniRef100_R9ZEZ4 ATPase n=115 Tax=Pseudomonas RepID=R9ZEZ4_PSEAI     120    9e-25 
  UniRef100_K6ZLS2 Two-component system, OmpR family, sensor kina...   120    9e-25 
  UniRef100_U6ALL5 Sensory histidine kinase in two-component regu...   120    9e-25 
  UniRef100_U9QDP3 Two-component system sensor n=1 Tax=Pseudomona...   120    9e-25 
  UniRef100_W6UWH1 Integral membrane sensor signal transduction h...   120    1e-24 
  UniRef100_Q2G519 Periplasmic sensor signal transduction histidi...   120    1e-24 
  UniRef100_W0WG88 Uncharacterized protein n=2 Tax=Pseudomonas ae...   120    1e-24 
  UniRef100_J7V526 Uncharacterized protein n=1 Tax=Stenotrophomon...   120    1e-24 
  UniRef100_UPI00029A3E61 histidine kinase n=1 Tax=Acinetobacter ...   120    1e-24 
  UniRef100_Q1NG47 Sensor histidine kinase n=1 Tax=Sphingomonas s...   120    1e-24 
  UniRef100_UPI0003B5E169 sensor histidine kinase n=1 Tax=Rhizobi...   120    1e-24 
  UniRef100_K5YVF8 Two-component sensor histidine kinase n=1 Tax=...   120    1e-24 
  UniRef100_B9BRD9 Periplasmic sensor signal transduction histidi...   120    1e-24 
  UniRef100_UPI000361CAF9 hypothetical protein n=1 Tax=Martelella...   120    1e-24 
  UniRef100_T2HDN2 Two-component histidine kinase n=1 Tax=Pseudom...   120    1e-24 
  UniRef100_Q1GV43 Periplasmic sensor signal transduction histidi...   120    1e-24 
  UniRef100_I5CU34 Integral membrane sensor signal transduction h...   120    1e-24 
  UniRef100_A0A009RLE8 HAMP domain protein n=1 Tax=Acinetobacter ...   120    1e-24 
  UniRef100_UPI00037AAFC2 hypothetical protein n=1 Tax=Marinobact...   120    1e-24 
  UniRef100_L0KN22 Signal transduction histidine kinase n=1 Tax=M...   120    1e-24 
  UniRef100_G0F021 Osmolarity sensor protein EnvZ n=1 Tax=Cupriav...   120    1e-24 
  UniRef100_F4GPN2 Two-component sensor kinase n=1 Tax=Pusillimon...   120    1e-24 
  UniRef100_C2HY27 Copper sensory histidine kinase CpxA n=1 Tax=V...   120    1e-24 
  UniRef100_UPI000370DC41 histidine kinase, partial n=1 Tax=Vario...   120    1e-24 
  UniRef100_Q1I977 Putative sensor histidine kinase n=1 Tax=Pseud...   120    1e-24 
  UniRef100_J4R6K8 GHKL domain protein n=1 Tax=Burkholderia multi...   120    1e-24 
  UniRef100_N9S6Y0 Uncharacterized protein n=1 Tax=Acinetobacter ...   120    1e-24 
  UniRef100_Q2SEU5 Signal transduction histidine kinase n=1 Tax=H...   120    1e-24 
  UniRef100_W7E3N1 Integral membrane sensor signal transduction h...   120    1e-24 
  UniRef100_N9DD37 Uncharacterized protein n=1 Tax=Acinetobacter ...   120    1e-24 
  UniRef100_L8J7Y9 Integral membrane sensor signal transduction h...   120    1e-24 
  UniRef100_UPI000378080A hypothetical protein n=1 Tax=Psychromon...   120    1e-24 
  UniRef100_N9D3F4 Uncharacterized protein n=1 Tax=Acinetobacter ...   120    1e-24 
  UniRef100_A0A009YVN9 HAMP domain protein n=1 Tax=Acinetobacter ...   120    1e-24 
  UniRef100_J7Q9X3 Integral membrane sensor signal transduction h...   120    1e-24 
  UniRef100_H0TN35 Sensor protein n=1 Tax=Bradyrhizobium sp. STM ...   120    1e-24 
  UniRef100_T1X5J1 Putative signal transduction histidine kinase ...   120    1e-24 
  UniRef100_T0GP47 Histidine kinase n=1 Tax=Sphingobium baderi LL...   120    1e-24 
  UniRef100_B7J687 Sensor histidine kinase n=1 Tax=Acidithiobacil...   120    1e-24 
  UniRef100_J7VD11 Uncharacterized protein n=1 Tax=Stenotrophomon...   120    1e-24 
  UniRef100_UPI0001CC3DAF sensor histidine kinase n=1 Tax=Pseudom...   120    1e-24 
  UniRef100_UPI00026C826A histidine kinase n=1 Tax=Fluoribacter d...   120    1e-24 
  UniRef100_A9AMJ1 Integral membrane sensor signal transduction h...   120    1e-24 
  UniRef100_T0IJH7 Histidine kinase n=1 Tax=Sphingobium quisquili...   120    1e-24 
  UniRef100_E1VJK1 Signal transduction histidine kinase sensor n=...   120    1e-24 
  UniRef100_J5C632 GHKL domain protein n=1 Tax=Burkholderia multi...   120    1e-24 
  UniRef100_B9AY41 Periplasmic sensor signal transduction histidi...   120    1e-24 
  UniRef100_M3FBV6 Uncharacterized protein n=1 Tax=Stenotrophomon...   120    1e-24 
  UniRef100_J2JJX6 Signal transduction histidine kinase n=1 Tax=V...   120    1e-24 
  UniRef100_X7BSE4 Two-component system sensor n=1 Tax=Pseudomona...   120    1e-24 
  UniRef100_A0A009M7D7 HAMP domain protein n=2 Tax=Acinetobacter ...   120    1e-24 
  UniRef100_S6JS61 Sensor histidine kinase n=1 Tax=Pseudomonas st...   120    1e-24 
  UniRef100_F8VD89 Two component sensor kinase n=2 Tax=Salmonella...   120    1e-24 
  UniRef100_J2PGM6 Signal transduction histidine kinase n=1 Tax=P...   120    1e-24 
  UniRef100_J3DSY1 Signal transduction histidine kinase n=1 Tax=P...   120    1e-24 
  UniRef100_J2WPJ5 Signal transduction histidine kinase n=1 Tax=P...   120    1e-24 
  UniRef100_J2SQ77 Signal transduction histidine kinase n=1 Tax=P...   120    1e-24 
  UniRef100_A0A009JSI8 HAMP domain protein n=1 Tax=Acinetobacter ...   120    1e-24 
  UniRef100_UPI00029B40EE two component sensor histidine kinase n...   120    1e-24 
  UniRef100_Q1GXN6 Periplasmic sensor signal transduction histidi...   120    1e-24 
  UniRef100_A8GNE8 Osmolarity sensor protein EnvZ n=1 Tax=Rickett...   120    1e-24 
  UniRef100_B2FRQ2 Putative transmembrane two component system se...   120    1e-24 
  UniRef100_C0ASA3 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   120    1e-24 
  UniRef100_Q1Q8A2 Histidine kinase n=1 Tax=Psychrobacter cryohal...   120    1e-24 
  UniRef100_F2N046 Sensor histidine kinase n=1 Tax=Pseudomonas st...   120    1e-24 
  UniRef100_F8H685 Sensor histidine kinase n=1 Tax=Pseudomonas st...   120    1e-24 
  UniRef100_U1LB21 Periplasmic sensor signal transduction histidi...   120    1e-24 
  UniRef100_UPI0002D8C215 histidine kinase n=1 Tax=Acinetobacter ...   120    1e-24 
  UniRef100_H2IXJ5 Signal transduction histidine kinase n=1 Tax=R...   120    1e-24 
  UniRef100_A0K6H6 Periplasmic sensor signal transduction histidi...   120    1e-24 
  UniRef100_UPI000263085B integral membrane sensor signal transdu...   120    1e-24 
  UniRef100_W8PN27 Histidine kinase n=1 Tax=Pseudomonas brassicac...   120    1e-24 
  UniRef100_C2IQV0 Copper sensory histidine kinase CpxA n=1 Tax=V...   120    1e-24 
  UniRef100_A3EJB7 Sensor protein CpxA n=1 Tax=Vibrio cholerae V5...   120    1e-24 
  UniRef100_F3WUR5 HAMP domain protein n=1 Tax=Sphingomonas sp. S...   120    2e-24 
  UniRef100_V8CUC2 ATP-binding protein n=1 Tax=Williamsia sp. D3 ...   120    2e-24 
  UniRef100_UPI0002F8A90A sensor histidine kinase n=1 Tax=Pseudom...   120    2e-24 
  UniRef100_K2CR05 Sensor protein n=1 Tax=uncultured bacterium Re...   120    2e-24 
  UniRef100_J3BAI6 Signal transduction histidine kinase n=1 Tax=P...   120    2e-24 
  UniRef100_F9C287 Sensor protein CpxA n=2 Tax=Vibrio cholerae Re...   120    2e-24 
  UniRef100_UPI0003780EC4 ATPase n=1 Tax=Rhizobium loti RepID=UPI...   120    2e-24 
  UniRef100_J2YM67 Sensor histidine kinase n=1 Tax=Pseudomonas ch...   120    2e-24 
  UniRef100_J2LZT8 Signal transduction histidine kinase n=1 Tax=P...   120    2e-24 
  UniRef100_V9UDU8 Sensor histidine kinase n=2 Tax=Pseudomonas mo...   120    2e-24 
  UniRef100_M3G4T3 Sensor histidine kinase n=1 Tax=Stenotrophomon...   120    2e-24 
  UniRef100_B2FSP3 Putative transmembane sensor histidine kinase ...   120    2e-24 
  UniRef100_F8FXB1 Integral membrane sensor signal transduction h...   120    2e-24 
  UniRef100_U3AB86 Uncharacterized protein n=1 Tax=Loktanella cin...   120    2e-24 
  UniRef100_A2VR53 Signal transduction histidine kinase n=1 Tax=B...   120    2e-24 
  UniRef100_L0M1W6 Signal transduction histidine kinase n=1 Tax=E...   120    2e-24 
  UniRef100_G7BAT4 Sensor protein CpxA n=2 Tax=Vibrio cholerae Re...   120    2e-24 
  UniRef100_F9T6K1 Sensory histidine kinase in two-component regu...   120    2e-24 
  UniRef100_V9WSG6 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   120    2e-24 
  UniRef100_I1DJJ9 Signal transduction histidine kinase n=2 Tax=V...   120    2e-24 
  UniRef100_F7Y111 Integral membrane sensor signal transduction h...   120    2e-24 
  UniRef100_W2D929 Putative two-component sensor histidine kinase...   120    2e-24 
  UniRef100_J0U8G3 Signal transduction histidine kinase n=1 Tax=A...   120    2e-24 
  UniRef100_S6H0G9 Sensor histidine kinase n=1 Tax=Pseudomonas sp...   120    2e-24 
  UniRef100_UPI0003D2B7F2 signal transduction histidine kinase n=...   120    2e-24 
  UniRef100_L0FH39 Integral membrane sensor signal transduction h...   120    2e-24 
  UniRef100_U2MLJ4 Sensor histidine kinase n=1 Tax=Pantoea sp. AS...   120    2e-24 
  UniRef100_G5FTA6 Uncharacterized protein n=1 Tax=Pseudomonas sp...   120    2e-24 
  UniRef100_D2YE84 Sensor protein CpxA n=1 Tax=Vibrio mimicus VM6...   120    2e-24 
  UniRef100_A5F4V0 Sensor protein CpxA n=95 Tax=Vibrio cholerae R...   120    2e-24 
  UniRef100_B6WUI5 ATPase/histidine kinase/DNA gyrase B/HSP90 dom...   120    2e-24 
  UniRef100_A6A283 Sensor protein CpxA n=3 Tax=Vibrio cholerae Re...   120    2e-24 
  UniRef100_U5VMA4 Integral membrane sensor signal transduction h...   120    2e-24 
  UniRef100_X7E2I8 Histidine kinase n=1 Tax=Marinomonas ushuaiens...   120    2e-24 
  UniRef100_UPI00037F220C histidine kinase n=1 Tax=Acidovorax sp....   120    2e-24 
  UniRef100_UPI0003704693 hypothetical protein n=1 Tax=Terediniba...   120    2e-24 
  UniRef100_UPI000329BA77 PREDICTED: sensor protein RstB-like n=1...   120    2e-24 
  UniRef100_A4CVB5 Two-component sensor histidine kinase n=1 Tax=...   120    2e-24 
  UniRef100_I3IEN1 Putative two-component regulatory system, sens...   120    2e-24 
  UniRef100_K8R7J5 Integral membrane sensor signal transduction h...   120    2e-24 
  UniRef100_J2MC27 Signal transduction histidine kinase n=2 Tax=P...   120    2e-24 
  UniRef100_T1H9N3 Uncharacterized protein n=1 Tax=Rhodnius proli...   120    2e-24 
  UniRef100_C5BQP9 Periplasmic sensor signal transduction histidi...   119    2e-24 
  UniRef100_J3HAD8 Signal transduction histidine kinase n=1 Tax=P...   119    2e-24 
  UniRef100_C3K756 Putative two-component system, sensor kinase n...   119    2e-24 
  UniRef100_A6XUE7 Sensor protein CpxA n=2 Tax=Vibrio cholerae Re...   119    2e-24 
  UniRef100_J2K5W2 Signal transduction histidine kinase n=1 Tax=V...   119    2e-24 
  UniRef100_A4BK17 Signal transduction histidine kinase n=1 Tax=R...   119    2e-24 
  UniRef100_E8XNE7 Integral membrane sensor signal transduction h...   119    2e-24 
  UniRef100_UPI0003607089 sensor histidine kinase n=1 Tax=Legione...   119    2e-24 
  UniRef100_UPI0002F302E0 hypothetical protein n=1 Tax=Pseudomona...   119    2e-24 
  UniRef100_UPI0002E8F2DE sensor histidine kinase n=1 Tax=Pseudom...   119    2e-24 
  UniRef100_A4CA88 Sensor protein RstB n=1 Tax=Pseudoalteromonas ...   119    2e-24 
  UniRef100_J3HEV9 Signal transduction histidine kinase n=1 Tax=P...   119    2e-24 
  UniRef100_I7JM14 Sensor kinase protein n=1 Tax=Taylorella asini...   119    2e-24 
  UniRef100_F1WI35 Two-component system sensor histidine kinase n...   119    2e-24 
  UniRef100_UPI0003619EF5 histidine kinase n=1 Tax=Sphingobium xe...   119    2e-24 
  UniRef100_UPI000306F69A transcriptional regulator n=1 Tax=Steno...   119    2e-24 
  UniRef100_UPI0001A445B7 sensor protein RstB n=1 Tax=Pectobacter...   119    2e-24 
  UniRef100_H7E5W3 ATPase, histidine kinase-, DNA gyrase B-, and ...   119    2e-24 
  UniRef100_V4MNW6 ATPase n=1 Tax=Pseudomonas aeruginosa HB15 Rep...   119    2e-24 
  UniRef100_U8XRX5 Two-component system sensor n=1 Tax=Pseudomona...   119    2e-24 
  UniRef100_UPI0002F6D2FE sensor histidine kinase n=1 Tax=Pseudom...   119    2e-24 
  UniRef100_R0DF21 Uncharacterized protein n=1 Tax=Salmonella ent...   119    2e-24 
  UniRef100_UPI000373822E sensor histidine kinase n=1 Tax=Pseudom...   119    2e-24 
  UniRef100_Q1QZS7 Periplasmic sensor signal transduction histidi...   119    2e-24 
  UniRef100_UPI00037B913D histidine kinase n=1 Tax=Sphingobium xe...   119    2e-24 
  UniRef100_U8MB63 Two-component system sensor n=1 Tax=Pseudomona...   119    2e-24 
  UniRef100_K5DCA8 Periplasmic sensor signal transduction histidi...   119    2e-24 
  UniRef100_A2PXZ5 Sensor protein CpxA (Fragment) n=1 Tax=Vibrio ...   119    2e-24 
  UniRef100_I0KKW5 Sensor histidine kinase n=1 Tax=Stenotrophomon...   119    2e-24 
  UniRef100_W2V5W1 Signal transduction histidine kinase n=1 Tax=L...   119    2e-24 
  UniRef100_L7CHE1 Periplasmic sensor signal transduction histidi...   119    2e-24 
  UniRef100_J2UD44 Signal transduction histidine kinase n=1 Tax=P...   119    2e-24 
  UniRef100_UPI0003770B04 hypothetical protein n=1 Tax=Terediniba...   119    2e-24 
  UniRef100_E4R8M6 Histidine kinase n=1 Tax=Pseudomonas putida (s...   119    2e-24 
  UniRef100_F3E4E9 Sensor histidine kinase n=5 Tax=Pseudomonas sy...   119    2e-24 
  UniRef100_X5B9M0 Sensor protein RstB n=1 Tax=Salmonella enteric...   119    2e-24 
  UniRef100_Q08WW5 Periplasmic sensor signal transduction histidi...   119    2e-24 
  UniRef100_W0BFE1 Signal transduction histidine kinase n=1 Tax=L...   119    2e-24 
  UniRef100_X0QWA7 Sensor histidine kinase n=1 Tax=Psychrobacter ...   119    2e-24 
  UniRef100_F2IRJ7 Copper sensory histidine kinase CpxA n=8 Tax=V...   119    2e-24 
  UniRef100_J2RZN8 Signal transduction histidine kinase n=1 Tax=P...   119    2e-24 
  UniRef100_L8BEP2 Sensory histidine kinase in two-component regu...   119    2e-24 
  UniRef100_J1MNS6 Sensor protein CpxA n=6 Tax=Vibrio cholerae Re...   119    2e-24 
  UniRef100_UPI0002883410 sensor histidine kinase n=1 Tax=Pseudom...   119    2e-24 
  UniRef100_F9AUU9 Sensor protein CpxA n=20 Tax=Vibrio cholerae R...   119    2e-24 
  UniRef100_I4L7A5 Sensor histidine kinase n=1 Tax=Pseudomonas sy...   119    2e-24 
  UniRef100_Q92I28 Osmolarity sensor protein envZ n=1 Tax=Rickett...   119    3e-24 
  UniRef100_J3F7D0 Signal transduction histidine kinase n=1 Tax=P...   119    3e-24 
  UniRef100_K2JAE4 Histidine kinase n=1 Tax=Oceanibaculum indicum...   119    3e-24 
  UniRef100_UPI0003B4D8C2 histidine kinase n=1 Tax=Novosphingobiu...   119    3e-24 
  UniRef100_U5AFP7 ATPase n=2 Tax=Pseudomonas aeruginosa RepID=U5...   119    3e-24 
  UniRef100_A0A022MA13 Transcriptional regulator n=1 Tax=Stenotro...   119    3e-24 
  UniRef100_S6IHE0 Periplasmic sensor Signal transduction histidi...   119    3e-24 
  UniRef100_G5NUE0 Sensory histidine kinase in two-component regu...   119    3e-24 
  UniRef100_F2AUF9 Periplasmic sensor signal transduction histidi...   119    3e-24 
  UniRef100_B6B7M7 Sensor histidine kinase n=1 Tax=Rhodobacterale...   119    3e-24 
  UniRef100_UPI000367ABD3 histidine kinase n=1 Tax=Vibrio genomos...   119    3e-24 
  UniRef100_UPI000305C9B3 hypothetical protein n=1 Tax=Chelatococ...   119    3e-24 
  UniRef100_E2XS41 Periplasmic sensor signal transduction histidi...   119    3e-24 


> UniRef100_P0AEJ4 Osmolarity sensor protein EnvZ n=426 Tax=Enterobacteriaceae 
RepID=ENVZ_ECOLI
Length=450

 Score =  921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/450 (100%), Positives = 450/450 (100%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_H4Y7C6 EnvZ n=1 Tax=Escherichia coli DEC7D RepID=H4Y7C6_ECOLX
Length=450

 Score =  920 bits (2378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 450/450 (100%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRT+LMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTMLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_E7SI46 Osmolarity sensory histidine kinase EnvZ n=1 
Tax=Shigella dysenteriae CDC 74-1112 RepID=E7SI46_SHIDY
Length=450

 Score =  920 bits (2378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 450/450 (100%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELG+SERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGSSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_C8TJJ4 Sensory histidine kinase EnvZ in two-component 
regulatory system with OmpR n=24 Tax=Escherichia coli RepID=C8TJJ4_ECO26
Length=450

 Score =  920 bits (2377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 450/450 (100%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIDVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_UPI0003A51852 osmolarity sensor protein n=1 Tax=Escherichia 
coli RepID=UPI0003A51852
Length=450

 Score =  920 bits (2377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 450/450 (100%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAP+QRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPKQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_B2U3L2 Osmolarity sensor protein EnvZ n=1 Tax=Shigella 
boydii serotype 18 (strain CDC 3083-94 / BS512) RepID=B2U3L2_SHIB3
Length=450

 Score =  920 bits (2377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 450/450 (100%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIK+SS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKLSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_G1YF88 Osmolarity sensor protein envZ n=2 Tax=Escherichia 
coli RepID=G1YF88_ECOLX
Length=450

 Score =  919 bits (2376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            EL TSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELSTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_C3SC37 Protein histidine kinase/phosphatase EnvZ n=148 
Tax=Escherichia coli RepID=C3SC37_ECOLX
Length=450

 Score =  919 bits (2376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQ TTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQSTTKEG  450


> UniRef100_B7NE09 Sensory histidine kinase in two-component regulatory 
system with OmpR n=150 Tax=Escherichia RepID=B7NE09_ECOLU
Length=450

 Score =  919 bits (2376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_M8RXE9 Osmolarity sensor protein envZ n=7 Tax=Escherichia 
coli RepID=M8RXE9_ECOLX
Length=450

 Score =  919 bits (2375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHM AGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMTAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_E1HMZ5 Osmolarity sensor protein EnvZ n=2 Tax=Escherichia 
coli RepID=E1HMZ5_ECOLX
Length=450

 Score =  918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_B7L4T4 Sensory histidine kinase in two-component regulatory 
system with OmpR n=54 Tax=Escherichia coli RepID=B7L4T4_ECO55
Length=450

 Score =  918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGT KEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTIKEG  450


> UniRef100_U5M4A7 Sensory histidine kinase in two-component regulatory 
system with OmpR n=1 Tax=Escherichia coli C321.deltaA 
RepID=U5M4A7_ECOLI
Length=450

 Score =  918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGL LAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLRLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_UPI0003A16341 osmolarity sensor protein n=1 Tax=Escherichia 
coli RepID=UPI0003A16341
Length=450

 Score =  918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIR WLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRPWLPVPVTRAQGTTKEG  450


> UniRef100_UPI00039F9BB0 osmolarity sensor protein n=1 Tax=Escherichia 
coli RepID=UPI00039F9BB0
Length=450

 Score =  918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQ EDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQGEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_N2Y4W4 Osmolarity sensor protein envZ n=2 Tax=Escherichia 
coli RepID=N2Y4W4_ECOLX
Length=450

 Score =  918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
             SHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  GSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_N2VQX0 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli P0298942.7 RepID=N2VQX0_ECOLX
Length=450

 Score =  918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQ GKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQGGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_M8Z6S0 Osmolarity sensor protein envZ n=2 Tax=Escherichia 
coli RepID=M8Z6S0_ECOLX
Length=450

 Score =  918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASE RSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEGRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_B7LSA7 Sensory histidine kinase in two-component regulatory 
system with OmpR n=5 Tax=Escherichia RepID=B7LSA7_ESCF3
Length=450

 Score =  918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLP+PVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPMPVTRAQGTTKEG  450


> UniRef100_L3PZG6 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli KTE75 RepID=L3PZG6_ECOLX
Length=450

 Score =  917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELG+SERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGSSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_B7M1W0 Sensory histidine kinase in two-component regulatory 
system with OmpR n=7 Tax=Escherichia coli RepID=B7M1W0_ECO8A
Length=450

 Score =  917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQ KHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQCKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_UPI0003EF1246 osmolarity sensor protein n=1 Tax=Escherichia 
coli RepID=UPI0003EF1246
Length=450

 Score =  917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/450 (99%), Positives = 448/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQ RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQKRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_C6UG04 Osmolarity sensor protein n=2 Tax=Escherichia 
coli RepID=C6UG04_ECOBR
Length=450

 Score =  917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAIL SLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILLSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_T6MJ56 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli HVH 91 (4-4638751) RepID=T6MJ56_ECOLX
Length=450

 Score =  917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM MEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMLMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_F4M535 Osmolarity sensor protein EnvZ n=2 Tax=Escherichia 
coli RepID=F4M535_ECOLX
Length=450

 Score =  917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFS RSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSLRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_N3F4G2 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli P0301867.11 RepID=N3F4G2_ECOLX
Length=450

 Score =  917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIV LLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVPLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_A1AGT0 Osmolarity sensor protein EnvZ n=306 Tax=Escherichia 
RepID=A1AGT0_ECOK1
Length=450

 Score =  917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/450 (99%), Positives = 448/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQG TKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGMTKEG  450


> UniRef100_W0AVU2 Osmolarity sensory histidine kinase EnvZ n=3 
Tax=Escherichia albertii RepID=W0AVU2_9ESCH
Length=450

 Score =  917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIML+AIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLMAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_E2QFQ4 Osmolarity sensor protein envZ n=94 Tax=Escherichia 
coli RepID=E2QFQ4_ECOLX
Length=450

 Score =  917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/450 (99%), Positives = 448/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQG TKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGATKEG  450


> UniRef100_UPI0003A6F712 osmolarity sensor protein n=1 Tax=Escherichia 
coli RepID=UPI0003A6F712
Length=450

 Score =  916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKM PLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMPPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_M8LFP3 Osmolarity sensor protein envZ n=7 Tax=Escherichia 
coli RepID=M8LFP3_ECOLX
Length=450

 Score =  916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRK LFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKPLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_UPI0003EF8771 osmolarity sensor protein n=1 Tax=Escherichia 
coli RepID=UPI0003EF8771
Length=450

 Score =  916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/450 (99%), Positives = 448/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNH GML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHIGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_T9SMR3 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli UMEA 3703-1 RepID=T9SMR3_ECOLX
Length=450

 Score =  916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/450 (99%), Positives = 448/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYE EIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYELEIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_N2DN61 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli 2735000 RepID=N2DN61_ECOLX
Length=450

 Score =  916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/450 (99%), Positives = 448/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIV LLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVPLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHM AGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMTAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_B7NMG9 Sensory histidine kinase in two-component regulatory 
system with OmpR n=5 Tax=Escherichia coli RepID=B7NMG9_ECO7I
Length=450

 Score =  915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/450 (99%), Positives = 447/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELG SERGGLSIRAWLPVPVTRAQG TKEG
Sbjct  421  ELGISERGGLSIRAWLPVPVTRAQGMTKEG  450


> UniRef100_T5P009 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli HVH 9 (4-6942539) RepID=T5P009_ECOLX
Length=450

 Score =  915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/450 (99%), Positives = 447/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRP VDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPFVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQG TKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGMTKEG  450


> UniRef100_T7MV56 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli HVH 175 (4-3405184) RepID=T7MV56_ECOLX
Length=450

 Score =  915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/450 (99%), Positives = 447/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSAR ISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARAISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQG TKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGMTKEG  450


> UniRef100_Q0P6L5 EnvZ variant n=1 Tax=Escherichia coli RepID=Q0P6L5_ECOLX
Length=450

 Score =  915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/450 (99%), Positives = 449/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREI+RELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIHRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIE FIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIELFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_V1D369 Osmolarity sensor protein EnvZ n=1 Tax=Escherichia 
coli A25922R RepID=V1D369_ECOLX
Length=450

 Score =  915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/450 (99%), Positives = 447/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEA LRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAALRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQG TKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGMTKEG  450


> UniRef100_V8SE45 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli HVH 23 (4-6066488) RepID=V8SE45_ECOLX
Length=450

 Score =  914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/450 (99%), Positives = 447/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYP SIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPSSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQG TKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGMTKEG  450


> UniRef100_T8UGZ5 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli UMEA 3160-1 RepID=T8UGZ5_ECOLX
Length=450

 Score =  914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/450 (99%), Positives = 447/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQ GYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQGGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQG TKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGMTKEG  450


> UniRef100_D8A6U3 Osmolarity sensor protein EnvZ n=2 Tax=Escherichia 
coli RepID=D8A6U3_ECOLX
Length=450

 Score =  914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/450 (99%), Positives = 447/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G EPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GMEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQG TKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGMTKEG  450


> UniRef100_UPI0003EE67A6 osmolarity sensor protein n=1 Tax=Escherichia 
coli RepID=UPI0003EE67A6
Length=450

 Score =  914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/450 (99%), Positives = 447/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M RLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MGRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQG TKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGMTKEG  450


> UniRef100_N3YQW8 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli P0304816.11 RepID=N3YQW8_ECOLX
Length=450

 Score =  914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/450 (99%), Positives = 448/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANM VNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMGVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQ EDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQGEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_N4BZF3 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli P0304816.7 RepID=N4BZF3_ECOLX
Length=450

 Score =  913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/450 (99%), Positives = 448/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQ EDDGPGIAPEQRK LFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQGEDDGPGIAPEQRKPLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_E6NZX6 Osmolarity sensor protein envZ n=111 Tax=Enterobacteriaceae 
RepID=E6NZX6_ECOD1
Length=447

 Score =  913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/447 (99%), Positives = 447/447 (100%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQGTTKEG  447


> UniRef100_N3LLU7 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli P0299483.1 RepID=N3LLU7_ECOLX
Length=450

 Score =  913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/450 (99%), Positives = 448/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQ K LFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQCKPLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_N4PT12 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli P0302308.14 RepID=N4PT12_ECOLX
Length=450

 Score =  913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/450 (99%), Positives = 448/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIV LLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVPLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRK LFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKPLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_L2VK96 Osmolarity sensor protein envZ n=4 Tax=Escherichia 
coli RepID=L2VK96_ECOLX
Length=450

 Score =  912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/450 (98%), Positives = 447/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETAL PGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALEPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGI PEQRKHLFQPFVRGDSARTISGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIEPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_I6FK69 Osmolarity sensor protein envZ n=1 Tax=Shigella 
dysenteriae 225-75 RepID=I6FK69_SHIDY
Length=447

 Score =  912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/447 (99%), Positives = 447/447 (100%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            +SERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  SSERGGLSIRAWLPVPVTRAQGTTKEG  447


> UniRef100_E7HHD5 Osmolarity sensor protein envZ n=6 Tax=Escherichia 
coli RepID=E7HHD5_ECOLX
Length=447

 Score =  912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/447 (99%), Positives = 447/447 (100%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIDVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQGTTKEG  447


> UniRef100_N3N319 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli P0301904.3 RepID=N3N319_ECOLX
Length=447

 Score =  912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/447 (99%), Positives = 447/447 (100%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAP+QRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPKQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQGTTKEG  447


> UniRef100_G1YVU0 Osmolarity sensor protein envZ n=2 Tax=Escherichia 
coli RepID=G1YVU0_ECOLX
Length=447

 Score =  912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/447 (99%), Positives = 446/447 (99%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQGTTKEG  447


> UniRef100_F3WNU9 Osmolarity sensor protein envZ n=1 Tax=Shigella 
boydii 5216-82 RepID=F3WNU9_SHIBO
Length=447

 Score =  912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/447 (99%), Positives = 447/447 (100%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWF+VEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFKVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQGTTKEG  447


> UniRef100_M8X1E5 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli 2851500 RepID=M8X1E5_ECOLX
Length=450

 Score =  912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/450 (99%), Positives = 447/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHM AGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMTAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQ EDDGPGIAPEQRK LFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQGEDDGPGIAPEQRKPLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_M8R8L6 Osmolarity sensor protein envZ n=6 Tax=Escherichia 
coli RepID=M8R8L6_ECOLX
Length=447

 Score =  912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/447 (99%), Positives = 446/447 (99%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHM AGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMTAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQGTTKEG  447


> UniRef100_H4MEL9 EnvZ n=71 Tax=Escherichia coli RepID=H4MEL9_ECOLX
Length=447

 Score =  911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/447 (99%), Positives = 446/447 (99%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQ TTKEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQSTTKEG  447


> UniRef100_UPI0003619FE4 osmolarity sensor protein n=1 Tax=Escherichia 
coli RepID=UPI0003619FE4
Length=450

 Score =  911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/449 (99%), Positives = 445/449 (99%), Gaps = 0/449 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
              NRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  FHNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKE  449
            ELGTSERGGLSIRAWLPVPVTRAQG TKE
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGATKE  449


> UniRef100_H5Q553 EnvZ n=4 Tax=Escherichia coli RepID=H5Q553_ECOLX
Length=447

 Score =  911 bits (2354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/447 (99%), Positives = 446/447 (99%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQGT KEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQGTIKEG  447


> UniRef100_M8QNB3 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli BCE034_MS-14 RepID=M8QNB3_ECOLX
Length=447

 Score =  910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/447 (99%), Positives = 446/447 (99%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIR WLPVPVTRAQGTTKEG
Sbjct  421  TSERGGLSIRPWLPVPVTRAQGTTKEG  447


> UniRef100_M8LHT0 Osmolarity sensor protein envZ n=3 Tax=Escherichia 
coli RepID=M8LHT0_ECOLX
Length=447

 Score =  910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/447 (99%), Positives = 446/447 (99%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQ EDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQGEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQGTTKEG  447


> UniRef100_A0A017J8G1 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli 1-110-08_S4_C3 RepID=A0A017J8G1_ECOLX
Length=447

 Score =  910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/447 (99%), Positives = 446/447 (99%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG SH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGGSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQGTTKEG  447


> UniRef100_F1ZND8 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli STEC_7v RepID=F1ZND8_ECOLX
Length=447

 Score =  910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/447 (99%), Positives = 446/447 (99%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLP+PVTRAQGTTKEG
Sbjct  421  TSERGGLSIRAWLPMPVTRAQGTTKEG  447


> UniRef100_M9BDR2 Osmolarity sensor protein envZ n=3 Tax=Escherichia 
coli RepID=M9BDR2_ECOLX
Length=447

 Score =  910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/447 (99%), Positives = 446/447 (99%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIV LLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVPLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQGTTKEG  447


> UniRef100_E3XSW3 Osmolarity sensor protein envZ n=6 Tax=Escherichia 
coli RepID=E3XSW3_ECOLX
Length=447

 Score =  909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/447 (99%), Positives = 445/447 (99%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQG TKEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQGMTKEG  447


> UniRef100_I4SL62 Osmolarity sensor protein n=2 Tax=Escherichia 
coli RepID=I4SL62_ECOLX
Length=447

 Score =  909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/447 (99%), Positives = 445/447 (99%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQG TKEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQGATKEG  447


> UniRef100_UPI0003A61B01 osmolarity sensor protein n=1 Tax=Escherichia 
coli RepID=UPI0003A61B01
Length=450

 Score =  909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/450 (99%), Positives = 447/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKM PLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMPPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQ EDDGPGIAPEQRK LFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQGEDDGPGIAPEQRKPLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450


> UniRef100_N2KF50 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli 2726950 RepID=N2KF50_ECOLX
Length=447

 Score =  909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/447 (99%), Positives = 446/447 (99%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKM PLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMPPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQGTTKEG  447


> UniRef100_M8Z9H5 Osmolarity sensor protein envZ n=5 Tax=Escherichia 
coli RepID=M8Z9H5_ECOLX
Length=447

 Score =  909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/447 (99%), Positives = 446/447 (99%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRK LFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKPLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQGTTKEG  447


> UniRef100_F0JU54 Osmolarity sensor protein n=1 Tax=Escherichia 
fergusonii ECD227 RepID=F0JU54_ESCFE
Length=447

 Score =  908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/447 (99%), Positives = 445/447 (99%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPV VTRAQGTTKEG
Sbjct  421  TSERGGLSIRAWLPVLVTRAQGTTKEG  447


> UniRef100_T8KCJ4 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli KOEGE 71 (186a) RepID=T8KCJ4_ECOLX
Length=450

 Score =  907 bits (2345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/450 (98%), Positives = 446/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQD YLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDSYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI+TAL PGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIDTALEPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGI PEQRKHLFQPFVRGDSARTISGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIEPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLP+PVTRAQGTTKEG
Sbjct  421  ELGTSERGGLSIRAWLPLPVTRAQGTTKEG  450


> UniRef100_A0A017I764 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli 1-176-05_S3_C2 RepID=A0A017I764_ECOLX
Length=450

 Score =  907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/450 (98%), Positives = 446/450 (99%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI+TAL PGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIDTALEPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGI PEQRKHLFQPFVRGDSARTISGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIEPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLP+PVTRAQG TKEG
Sbjct  421  ELGTSERGGLSIRAWLPLPVTRAQGATKEG  450


> UniRef100_A0A017JMD2 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli 1-110-08_S4_C1 RepID=A0A017JMD2_ECOLX
Length=447

 Score =  906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/447 (99%), Positives = 444/447 (99%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG SH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGGSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQG TKEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQGATKEG  447


> UniRef100_R8XC97 Osmolarity sensor protein envZ n=3 Tax=Escherichia 
coli RepID=R8XC97_ECOLX
Length=450

 Score =  905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/450 (98%), Positives = 445/450 (98%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQD YLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDSYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI+TAL PGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIDTALEPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGI PEQRKHLFQPFVRGDSARTISGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIEPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLP+PVTRAQG TKEG
Sbjct  421  ELGTSERGGLSIRAWLPLPVTRAQGATKEG  450


> UniRef100_N4IYR8 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli p0305293.12 RepID=N4IYR8_ECOLX
Length=447

 Score =  902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/447 (99%), Positives = 444/447 (99%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREIETALYPGSIEVKM PLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREIETALYPGSIEVKMPPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            PNRAWFQ EDDGPGIAPEQRK LFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG
Sbjct  361  PNRAWFQGEDDGPGIAPEQRKPLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  421  TSERGGLSIRAWLPVPVTRAQGTTKEG  447


> UniRef100_D4BI29 Osmolarity sensor protein EnvZ n=3 Tax=Citrobacter 
RepID=D4BI29_9ENTR
Length=450

 Score =  895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/450 (96%), Positives = 443/450 (98%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIETAL PGSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIETALLPGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTETHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVP TRAQGTTK+ 
Sbjct  421  EIGTSERGGLSIRAWLPVPFTRAQGTTKDA  450


> UniRef100_D2TLN5 Two-component sensor kinase n=1 Tax=Citrobacter 
rodentium (strain ICC168) RepID=D2TLN5_CITRI
Length=450

 Score =  894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/450 (96%), Positives = 442/450 (98%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREIETAL PGSI+++MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIETALQPGSIQLRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEP+RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  EIGTSERGGLSIRAWLPVPVARIQGTTKEA  450


> UniRef100_F8VKV3 Two-component sensor kinase EnvZ n=1 Tax=Salmonella 
bongori (strain ATCC 43975 / DSM 13772 / NCTC 12419) 
RepID=F8VKV3_SALBC
Length=450

 Score =  890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/450 (95%), Positives = 439/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  G I+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGCIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPVTR QG TKE 
Sbjct  421  EIGTSERGGLSIRAWLPVPVTRVQGATKEA  450


> UniRef100_K8QVM6 Osmolarity sensor protein n=4 Tax=Citrobacter 
RepID=K8QVM6_CITFR
Length=450

 Score =  890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/449 (95%), Positives = 442/449 (98%), Gaps = 0/449 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIETAL PG+I+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIETALQPGAIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTETHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKE  449
            E+GTSERGGLSIRAWLPVP TRAQG TK+
Sbjct  421  EIGTSERGGLSIRAWLPVPFTRAQGITKD  449


> UniRef100_P08982 Osmolarity sensor protein EnvZ n=738 Tax=Salmonella 
choleraesuis RepID=ENVZ_SALTY
Length=450

 Score =  888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/450 (95%), Positives = 439/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  EIGTSERGGLSIRAWLPVPVARVQGTTKEA  450


> UniRef100_E3Y890 Osmolarity sensor protein envZ n=2 Tax=Enterobacteriaceae 
RepID=E3Y890_SHIFL
Length=434

 Score =  887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/434 (99%), Positives = 434/434 (100%), Gaps = 0/434 (0%)

Query  17   LLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAF  76
            +LIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAF
Sbjct  1    MLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAF  60

Query  77   RREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLK  136
            RREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLK
Sbjct  61   RREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLK  120

Query  137  TWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQV  196
            TWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQV
Sbjct  121  TWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQV  180

Query  197  GKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLAT  256
            GKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLAT
Sbjct  181  GKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLAT  240

Query  257  EMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYE  316
            EMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYE
Sbjct  241  EMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYE  300

Query  317  REIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGP  376
            REIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGP
Sbjct  301  REIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGP  360

Query  377  GIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWL  436
            GIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWL
Sbjct  361  GIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWL  420

Query  437  PVPVTRAQGTTKEG  450
            PVPVTRAQGTTKEG
Sbjct  421  PVPVTRAQGTTKEG  434


> UniRef100_H7EE26 ATPase, histidine kinase-, DNA gyrase B-, and 
HSP90-like domain protein n=3 Tax=Salmonella houtenae RepID=H7EE26_SALHO
Length=450

 Score =  887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/450 (95%), Positives = 439/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLP+PV R QGTTKE 
Sbjct  421  EIGTSERGGLSIRAWLPIPVARVQGTTKEA  450


> UniRef100_J1G337 Osmolarity sensor protein n=5 Tax=Enterobacteriaceae 
RepID=J1G337_9ENTR
Length=450

 Score =  887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/449 (95%), Positives = 441/449 (98%), Gaps = 0/449 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIETAL PG+I+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIETALQPGAIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTETHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKE  449
            E+GTSERGGLSIRAWLPVP TRA G TK+
Sbjct  421  EIGTSERGGLSIRAWLPVPFTRAPGITKD  449


> UniRef100_C1MD79 Osmolarity sensor protein envZ n=3 Tax=Enterobacteriaceae 
RepID=C1MD79_9ENTR
Length=450

 Score =  887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/450 (95%), Positives = 440/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIETAL PGSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIETALLPGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GMEQHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVP TRA G TK+ 
Sbjct  421  EIGTSERGGLSIRAWLPVPFTRAPGNTKDA  450


> UniRef100_UPI0002BC5EEE osmolarity sensor protein n=1 Tax=Salmonella 
choleraesuis RepID=UPI0002BC5EEE
Length=450

 Score =  887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/450 (95%), Positives = 438/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIRVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  EIGTSERGGLSIRAWLPVPVARVQGTTKEA  450


> UniRef100_L6Y156 Osmolarity sensor protein n=1 Tax=Salmonella 
enterica subsp. enterica serovar Enteritidis str. SARB17 RepID=L6Y156_SALEN
Length=450

 Score =  887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/450 (95%), Positives = 439/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GT+ +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTKSHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  EIGTSERGGLSIRAWLPVPVARVQGTTKEA  450


> UniRef100_A8AQV8 Uncharacterized protein n=1 Tax=Citrobacter 
koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) RepID=A8AQV8_CITK8
Length=450

 Score =  886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/450 (95%), Positives = 441/450 (98%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKG+IPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGMIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI+TAL PGSI+VKMHPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIDTALQPGSIQVKMHPLSIKRAIANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEP+RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+G+SERGGLSIRAWLP+PV R  G+TK+ 
Sbjct  421  EIGSSERGGLSIRAWLPIPVARVPGSTKDA  450


> UniRef100_UPI0003180EAD osmolarity sensor protein n=1 Tax=Citrobacter 
freundii RepID=UPI0003180EAD
Length=447

 Score =  886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/447 (95%), Positives = 439/447 (98%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLN+
Sbjct  241  DLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNS  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEV+AAESGYEREIETAL PGSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVVAAESGYEREIETALLPGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
             +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGMLE+G
Sbjct  361  THRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGMLEIG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVP TRAQG TK+ 
Sbjct  421  TSERGGLSIRAWLPVPFTRAQGITKDA  447


> UniRef100_V2JUR3 Osmolarity sensor protein n=2 Tax=Salmonella 
enterica I RepID=V2JUR3_SALET
Length=450

 Score =  886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/450 (95%), Positives = 439/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQE+PMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEIPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  EIGTSERGGLSIRAWLPVPVARVQGTTKEA  450


> UniRef100_X3BRV1 Osmolarity sensor protein n=2 Tax=Salmonella 
enteritidis RepID=X3BRV1_SALEN
Length=450

 Score =  886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/450 (95%), Positives = 438/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVW KTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWFKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  EIGTSERGGLSIRAWLPVPVARVQGTTKEA  450


> UniRef100_V0S378 Osmolarity sensor protein EnvZ n=1 Tax=Escherichia 
coli 907446 RepID=V0S378_ECOLX
Length=434

 Score =  885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/434 (99%), Positives = 433/434 (99%), Gaps = 0/434 (0%)

Query  17   LLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAF  76
            +LIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAF
Sbjct  1    MLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAF  60

Query  77   RREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLK  136
            RREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLK
Sbjct  61   RREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLK  120

Query  137  TWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQV  196
            TWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQV
Sbjct  121  TWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQV  180

Query  197  GKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLAT  256
            GKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLAT
Sbjct  181  GKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLAT  240

Query  257  EMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYE  316
            EMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYE
Sbjct  241  EMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYE  300

Query  317  REIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGP  376
            REIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGP
Sbjct  301  REIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGP  360

Query  377  GIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWL  436
            GIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWL
Sbjct  361  GIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWL  420

Query  437  PVPVTRAQGTTKEG  450
            PVPVTRAQGTTKEG
Sbjct  421  PVPVTRAQGTTKEG  434


> UniRef100_P41406 Osmolarity sensor protein EnvZ n=5 Tax=Salmonella 
choleraesuis RepID=ENVZ_SALTI
Length=450

 Score =  885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/450 (95%), Positives = 438/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGN WIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNCWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  EIGTSERGGLSIRAWLPVPVARVQGTTKEA  450


> UniRef100_X7HJP9 Osmolarity sensor protein envZ n=1 Tax=Citrobacter 
freundii UCI 32 RepID=X7HJP9_CITFR
Length=450

 Score =  885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/450 (95%), Positives = 439/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIETAL PG I+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIETALLPGCIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GMEQHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVP TRA G TK+ 
Sbjct  421  EIGTSERGGLSIRAWLPVPFTRAPGNTKDA  450


> UniRef100_V2GZ44 Osmolarity sensor protein n=1 Tax=Salmonella 
enterica subsp. enterica serovar Albany str. ATCC 51960 RepID=V2GZ44_SALET
Length=450

 Score =  885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/450 (95%), Positives = 438/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVT LF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTSLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  EIGTSERGGLSIRAWLPVPVARVQGTTKEA  450


> UniRef100_F2FVK7 Osmolarity sensor protein n=9 Tax=Salmonella 
enterica I RepID=F2FVK7_SALGL
Length=450

 Score =  884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/450 (95%), Positives = 437/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGG WLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGVWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAA VKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAASVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  EIGTSERGGLSIRAWLPVPVARVQGTTKEA  450


> UniRef100_V1YS30 Osmolarity sensor protein n=1 Tax=Salmonella 
enterica subsp. enterica serovar Indiana str. ATCC 51959 RepID=V1YS30_SALET
Length=450

 Score =  884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/450 (95%), Positives = 438/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  EIGTSERGGLSIRAWLPVPVARVQGTTKEA  450


> UniRef100_UPI0003EB60BF osmolarity sensor protein n=1 Tax=Salmonella 
choleraesuis RepID=UPI0003EB60BF
Length=450

 Score =  884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/450 (95%), Positives = 438/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPV   QGTTKE 
Sbjct  421  EIGTSERGGLSIRAWLPVPVAPVQGTTKEA  450


> UniRef100_UPI0003EB55CA osmolarity sensor protein n=1 Tax=Salmonella 
choleraesuis RepID=UPI0003EB55CA
Length=450

 Score =  884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/450 (95%), Positives = 437/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAA QVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAAFQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+G SERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  EIGASERGGLSIRAWLPVPVARVQGTTKEA  450


> UniRef100_A9MMC4 Uncharacterized protein n=1 Tax=Salmonella arizonae 
(strain ATCC BAA-731 / CDC346-86 / RSK2980) RepID=A9MMC4_SALAR
Length=450

 Score =  884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/450 (95%), Positives = 438/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRK+LFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTESHRAWFQVEDDGPGIKPEQRKNLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPV R QG TKE 
Sbjct  421  EIGTSERGGLSIRAWLPVPVARVQGATKEA  450


> UniRef100_E8NSQ1 Osmolarity sensor protein n=4 Tax=Salmonella 
enterica subsp. enterica serovar Choleraesuis RepID=E8NSQ1_SALET
Length=450

 Score =  884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/450 (95%), Positives = 438/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI  EQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTESHRAWFQVEDDGPGIKLEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  EIGTSERGGLSIRAWLPVPVARVQGTTKEA  450


> UniRef100_X0N9Z6 Osmolarity sensor protein n=1 Tax=Salmonella 
enterica subsp. enterica serovar Namur str. 05-2929 RepID=X0N9Z6_SALET
Length=447

 Score =  883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/447 (95%), Positives = 437/447 (97%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSE+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLN+
Sbjct  241  DLRTPLTRIRLATEMMSEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNS  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
             +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGMLE+G
Sbjct  361  SHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGMLEIG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  TSERGGLSIRAWLPVPVARVQGTTKEA  447


> UniRef100_L9QGS1 Osmolarity sensor protein n=2 Tax=Salmonella 
enterica I RepID=L9QGS1_SALGL
Length=450

 Score =  883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/450 (95%), Positives = 437/450 (97%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGG WLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGVWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAA VKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAARVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  EIGTSERGGLSIRAWLPVPVARVQGTTKEA  450


> UniRef100_B4SVK4 Osmolarity sensor protein EnvZ n=9 Tax=Salmonella 
newport RepID=B4SVK4_SALNS
Length=447

 Score =  883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/447 (95%), Positives = 437/447 (97%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLN+
Sbjct  241  DLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNS  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
             +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGMLE+G
Sbjct  361  SHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGMLEIG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPV RAQGTTKE 
Sbjct  421  TSERGGLSIRAWLPVPVARAQGTTKEA  447


> UniRef100_S5N1A0 Osmolarity sensory histidine kinase EnvZ n=2 
Tax=Salmonella bongori RepID=S5N1A0_SALBN
Length=447

 Score =  882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/447 (95%), Positives = 436/447 (97%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLN+
Sbjct  241  DLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNS  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREI TAL  G I+VKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREINTALQAGCIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
            P+RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGMLE+G
Sbjct  361  PHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGMLEIG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTR QG TKE 
Sbjct  421  TSERGGLSIRAWLPVPVTRVQGATKEA  447


> UniRef100_X2M153 Osmolarity sensor protein n=10 Tax=Salmonella 
choleraesuis RepID=X2M153_SALEN
Length=495

 Score =  880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/447 (95%), Positives = 435/447 (97%), Gaps = 0/447 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTT  447
            E+GTSERGGLSIRAWLPVPV R  G T
Sbjct  421  EIGTSERGGLSIRAWLPVPVARXXGRT  447


> UniRef100_I6HFG8 Osmolarity sensor protein envZ n=1 Tax=Shigella 
flexneri 1235-66 RepID=I6HFG8_SHIFL
Length=447

 Score =  880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/446 (95%), Positives = 437/446 (97%), Gaps = 0/446 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLN+
Sbjct  241  DLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNS  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREI+TAL PG I+VKMHPLSIKRAVANMVVNAARYGNGWIKVSSG E
Sbjct  301  VLGEVIAAESGYEREIDTALRPGVIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGME  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
             +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGMLE+G
Sbjct  361  AHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGMLEIG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKE  449
            TSERGGLSIRAWLPVP TRAQG TK+
Sbjct  421  TSERGGLSIRAWLPVPFTRAQGITKD  446


> UniRef100_I0VW64 Integral membrane sensor signal transduction 
histidine kinase n=1 Tax=Escherichia coli W26 RepID=I0VW64_ECOLX
Length=429

 Score =  879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/429 (99%), Positives = 429/429 (100%), Gaps = 0/429 (0%)

Query  22   LLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIY  81
            +LFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIY
Sbjct  1    MLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIY  60

Query  82   RELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSP  141
            RELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSP
Sbjct  61   RELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSP  120

Query  142  NIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGII  201
            NIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGII
Sbjct  121  NIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGII  180

Query  202  PPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSE  261
            PPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSE
Sbjct  181  PPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSE  240

Query  262  QDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIET  321
            QDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIET
Sbjct  241  QDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIET  300

Query  322  ALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPE  381
            ALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPE
Sbjct  301  ALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPE  360

Query  382  QRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVT  441
            QRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVT
Sbjct  361  QRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVT  420

Query  442  RAQGTTKEG  450
            RAQGTTKEG
Sbjct  421  RAQGTTKEG  429


> UniRef100_V1PRL1 Osmolarity sensor protein n=2 Tax=Salmonella 
choleraesuis RepID=V1PRL1_SALET
Length=447

 Score =  878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/447 (95%), Positives = 435/447 (97%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSS VVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSLVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLN+
Sbjct  241  DLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNS  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
             +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGMLE+G
Sbjct  361  SHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGMLEIG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  TSERGGLSIRAWLPVPVARVQGTTKEA  447


> UniRef100_F9I0E7 EnvZ n=1 Tax=Escherichia coli O104:H4 str. C227-11 
RepID=F9I0E7_ECOLX
Length=439

 Score =  875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/430 (99%), Positives = 428/430 (99%), Gaps = 0/430 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420

Query  421  ELGTSERGGL  430
            ELGTSER G 
Sbjct  421  ELGTSERAGF  430


> UniRef100_N1GR65 Osmolarity sensor protein EnvZ n=2 Tax=Salmonella 
choleraesuis RepID=N1GR65_SALET
Length=447

 Score =  874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/447 (95%), Positives = 434/447 (97%), Gaps = 0/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQ GKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQGGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLN+
Sbjct  241  DLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNS  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
             +RAW QVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGMLE+G
Sbjct  361  SHRAWSQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGMLEIG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  TSERGGLSIRAWLPVPVARVQGTTKEA  447


> UniRef100_X3UUC8 Osmolarity sensor protein n=1 Tax=Salmonella 
enterica subsp. enterica serovar Enteritidis str. EC20120505 
RepID=X3UUC8_SALEN
Length=450

 Score =  874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/450 (94%), Positives = 434/450 (96%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE +RAWFQVED      PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GTESHRAWFQVEDXXXXXXPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  421  EIGTSERGGLSIRAWLPVPVARVQGTTKEA  450


> UniRef100_J7GQK1 Osmolarity sensor protein n=6 Tax=Enterobacter 
cloacae complex RepID=J7GQK1_ENTCL
Length=448

 Score =  873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/444 (95%), Positives = 434/444 (97%), Gaps = 0/444 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREI+TAL  G I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIDTALQAGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG+L
Sbjct  361  GSELNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQ  444
            E+GTSERGGLSIRAWLPVPVTR Q
Sbjct  421  EIGTSERGGLSIRAWLPVPVTRGQ  444


> UniRef100_I6RDP2 Osmolarity sensor protein n=1 Tax=Enterobacter 
cloacae subsp. dissolvens SDM RepID=I6RDP2_ENTCL
Length=448

 Score =  873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/450 (94%), Positives = 436/450 (96%), Gaps = 2/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREIET L  G I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIETDLQAGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG+L
Sbjct  361  GSELNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPVTR Q   KEG
Sbjct  421  EIGTSERGGLSIRAWLPVPVTRGQ--VKEG  448


> UniRef100_Y1GMK1 Osmolarity sensor protein envZ n=1 Tax=Enterobacter 
sp. BIDMC 29 RepID=Y1GMK1_9ENTR
Length=448

 Score =  872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/450 (94%), Positives = 436/450 (96%), Gaps = 2/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREI+T L  G I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIDTDLQDGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRIVDNHNG+L
Sbjct  361  GSELNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIVDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPVTR Q   KEG
Sbjct  421  EIGTSERGGLSIRAWLPVPVTRGQ--VKEG  448


> UniRef100_X5G3P4 Osmolarity sensor protein n=2 Tax=Enterobacter 
cloacae complex RepID=X5G3P4_ENTAS
Length=448

 Score =  871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/450 (94%), Positives = 436/450 (96%), Gaps = 2/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREI+T L  G I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIDTDLQAGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG+L
Sbjct  361  GSELNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPVTR Q   KEG
Sbjct  421  EIGTSERGGLSIRAWLPVPVTRGQ--VKEG  448


> UniRef100_D2ZIR2 ATPase/histidine kinase/DNA gyrase B/HSP90 domain 
protein n=1 Tax=Enterobacter cancerogenus ATCC 35316 RepID=D2ZIR2_9ENTR
Length=448

 Score =  871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/444 (95%), Positives = 433/444 (97%), Gaps = 0/444 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMP+EMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPLEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREI+T L  G I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIDTDLQAGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRIVDNHNG+L
Sbjct  361  GSELNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIVDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQ  444
            E+GTSERGGLSIRAWLPVPVTR Q
Sbjct  421  EIGTSERGGLSIRAWLPVPVTRGQ  444


> UniRef100_K4YB99 EnvZ Protein n=7 Tax=Enterobacter RepID=K4YB99_9ENTR
Length=448

 Score =  870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/444 (95%), Positives = 433/444 (97%), Gaps = 0/444 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREI+T L  G I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIDTDLQAGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRIVDNHNG+L
Sbjct  361  GSELNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIVDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQ  444
            E+GTSERGGLSIRAWLPVPVTR Q
Sbjct  421  EIGTSERGGLSIRAWLPVPVTRGQ  444


> UniRef100_G2S2H5 Integral membrane sensor signal transduction 
histidine kinase n=1 Tax=Enterobacter asburiae (strain LF7a) 
RepID=G2S2H5_ENTAL
Length=448

 Score =  870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/450 (94%), Positives = 436/450 (96%), Gaps = 2/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREI+T L  G I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIDTDLQVGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG+L
Sbjct  361  GSELNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+GTSERGGLSIRAWLPVPVTR Q   KEG
Sbjct  421  EIGTSERGGLSIRAWLPVPVTRGQ--VKEG  448


> UniRef100_V3HW98 Osmolarity sensor protein envZ n=2 Tax=Enterobacter 
RepID=V3HW98_ENTCL
Length=448

 Score =  870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/444 (94%), Positives = 433/444 (97%), Gaps = 0/444 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREI+T L  G I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIDTDLQAGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG+L
Sbjct  361  GSELNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQ  444
            E+GTSERGGLSIRAWLPVPVTR Q
Sbjct  421  EIGTSERGGLSIRAWLPVPVTRGQ  444


> UniRef100_G8LIB0 Osmolarity sensor protein envZ n=5 Tax=Enterobacter 
cloacae complex RepID=G8LIB0_ENTCL
Length=448

 Score =  870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/444 (95%), Positives = 433/444 (97%), Gaps = 0/444 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREI+T L  G I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIDTDLQAGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRIVDNHNG+L
Sbjct  361  GSELNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIVDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQ  444
            E+GTSERGGLSIRAWLPVPVTR Q
Sbjct  421  EIGTSERGGLSIRAWLPVPVTRGQ  444


> UniRef100_V3P7Q5 Osmolarity sensor protein envZ n=1 Tax=Enterobacter 
sp. MGH 24 RepID=V3P7Q5_9ENTR
Length=448

 Score =  870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/444 (94%), Positives = 433/444 (97%), Gaps = 0/444 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREI+T L  G I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIDTDLQTGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG+L
Sbjct  361  GSELNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQ  444
            E+GTSERGGLSIRAWLPVPVTR Q
Sbjct  421  EIGTSERGGLSIRAWLPVPVTRGQ  444


> UniRef100_F5S2X8 Osmolarity sensor protein EnvZ n=34 Tax=Enterobacter 
cloacae complex RepID=F5S2X8_9ENTR
Length=448

 Score =  870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/444 (95%), Positives = 431/444 (97%), Gaps = 0/444 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREI T L  G I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIATDLQAGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRIVDNHNG+L
Sbjct  361  GTELNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIVDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQ  444
            E+GTSERGGLSIRAWLPVPV R Q
Sbjct  421  EIGTSERGGLSIRAWLPVPVLRGQ  444


> UniRef100_A4WFJ2 Integral membrane sensor signal transduction 
histidine kinase n=1 Tax=Enterobacter sp. (strain 638) RepID=A4WFJ2_ENT38
Length=448

 Score =  869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/444 (94%), Positives = 433/444 (97%), Gaps = 0/444 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIML+AIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLMAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN VLGEV+AAESGYEREI+T L PG I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNGVLGEVVAAESGYEREIDTDLQPGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQV+DDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG+L
Sbjct  361  GSELNRAWFQVDDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQ  444
            E+GTSERGGLSIRAWLPVPVTR Q
Sbjct  421  EIGTSERGGLSIRAWLPVPVTRGQ  444


> UniRef100_V3MCS2 Osmolarity sensor protein envZ n=1 Tax=Enterobacter 
sp. MGH 34 RepID=V3MCS2_9ENTR
Length=448

 Score =  869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/444 (94%), Positives = 432/444 (97%), Gaps = 0/444 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREI+T L  G I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIDTDLQAGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGL IVQRIVDNHNG+L
Sbjct  361  GSELNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLTIVQRIVDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQ  444
            E+GTSERGGLSIRAWLPVPVTR Q
Sbjct  421  EIGTSERGGLSIRAWLPVPVTRGQ  444


> UniRef100_E3GB28 Integral membrane sensor signal transduction 
histidine kinase n=1 Tax=Enterobacter lignolyticus (strain 
SCF1) RepID=E3GB28_ENTLS
Length=450

 Score =  868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/449 (93%), Positives = 433/449 (96%), Gaps = 0/449 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYS+EAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSDEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREIET L PG I V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIETELQPGDIPVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G EPNR WFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG+L
Sbjct  361  GREPNRVWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKE  449
            E+ TS+RGGL IRAWLPVPV + QG TKE
Sbjct  421  EIDTSKRGGLLIRAWLPVPVAKVQGQTKE  449


> UniRef100_S9ZBS6 Osmolarity sensor protein n=1 Tax=Enterobacter 
cloacae EC_38VIM1 RepID=S9ZBS6_ENTCL
Length=448

 Score =  868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/444 (94%), Positives = 433/444 (97%), Gaps = 0/444 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRML+TD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLITD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREI+T L  G I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIDTDLQAGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRIVDNHNG+L
Sbjct  361  GSELNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIVDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQ  444
            E+GTSERGGLSIRAWLPVPVTR Q
Sbjct  421  EIGTSERGGLSIRAWLPVPVTRGQ  444


> UniRef100_U7CH05 Osmolarity sensor protein envZ n=2 Tax=Enterobacter 
cloacae complex RepID=U7CH05_9ENTR
Length=448

 Score =  868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/444 (95%), Positives = 430/444 (96%), Gaps = 0/444 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTW SPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWQSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREI T L  G I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIATDLQAGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRIVDNHNG+L
Sbjct  361  GTELNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIVDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQ  444
            E+GTSERGGLSIRAWLPVPV R Q
Sbjct  421  EIGTSERGGLSIRAWLPVPVLRGQ  444


> UniRef100_UPI0003A156E8 osmolarity sensor protein n=1 Tax=Enterobacter 
cloacae RepID=UPI0003A156E8
Length=445

 Score =  867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/447 (94%), Positives = 433/447 (96%), Gaps = 2/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEV+AAESGYEREIET L  G I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSSG+E
Sbjct  301  VLGEVVAAESGYEREIETDLQAGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSSGSE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
             NRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRIVDNHNG+LE+G
Sbjct  361  LNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIVDNHNGLLEIG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTR Q   KEG
Sbjct  421  TSERGGLSIRAWLPVPVTRGQ--VKEG  445


> UniRef100_D5CEG2 Osmolarity sensor protein n=1 Tax=Enterobacter 
cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 
13535 / NCDC 279-56) RepID=D5CEG2_ENTCC
Length=445

 Score =  865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/447 (94%), Positives = 433/447 (96%), Gaps = 2/447 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA
Sbjct  241  DLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEV+AAESGYEREI+T L  G I+V+MHPLSIKRAVANMVVNAARYGNGWIKVSSG+E
Sbjct  301  VLGEVVAAESGYEREIDTDLQAGEIQVRMHPLSIKRAVANMVVNAARYGNGWIKVSSGSE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
             NRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRIVDNHNG+LE+G
Sbjct  361  LNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIVDNHNGLLEIG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTTKEG  450
            TSERGGLSIRAWLPVPVTR Q   KEG
Sbjct  421  TSERGGLSIRAWLPVPVTRGQ--VKEG  445


> UniRef100_T7X0A5 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli HVH 204 (4-3112802) RepID=T7X0A5_ECOLX
Length=423

 Score =  865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/423 (99%), Positives = 422/423 (99%), Gaps = 0/423 (0%)

Query  28   VTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGIS  87
            +TTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGIS
Sbjct  1    MTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGIS  60

Query  88   LYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRV  147
            LYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRV
Sbjct  61   LYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRV  120

Query  148  PLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLRE  207
            PLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLRE
Sbjct  121  PLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLRE  180

Query  208  YGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLA  267
            YGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLA
Sbjct  181  YGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLA  240

Query  268  ESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGS  327
            ESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGS
Sbjct  241  ESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGS  300

Query  328  IEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLF  387
            IEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLF
Sbjct  301  IEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLF  360

Query  388  QPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTT  447
            QPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQG T
Sbjct  361  QPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGMT  420

Query  448  KEG  450
            KEG
Sbjct  421  KEG  423


> UniRef100_G9Z0P7 Osmolarity sensor protein EnvZ n=1 Tax=Yokenella 
regensburgei ATCC 43003 RepID=G9Z0P7_9ENTR
Length=449

 Score =  863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/445 (93%), Positives = 432/445 (97%), Gaps = 0/445 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYS+EAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSDEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSVEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEV+AAESGYEREI+T L  G I V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVVAAESGYEREIDTELQAGEIAVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+EPNRAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG+L
Sbjct  361  GSEPNRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQG  445
            E+GTSERGGL IRAWLP+PV+R  G
Sbjct  421  EIGTSERGGLLIRAWLPIPVSRIAG  445


> UniRef100_J1QMQ6 Osmolarity sensor protein envZ n=1 Tax=Kosakonia 
radicincitans DSM 16656 RepID=J1QMQ6_9ENTR
Length=450

 Score =  856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/450 (92%), Positives = 431/450 (95%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MMRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAAL+VG+G IPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALKVGRGHIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM+E+DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMAEEDGYLSESINKDIEECNAIIEQFIDYLRTGQEMPMEVAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIET L    I V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETGLNDSEIFVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NRAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG+L
Sbjct  361  GTELNRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGLSIRAWLP+PV R  G TKE 
Sbjct  421  ELGTSERGGLSIRAWLPIPVVRLNGPTKEA  450


> UniRef100_L0M0Z1 Signal transduction histidine kinase n=1 Tax=Enterobacteriaceae 
bacterium (strain FGI 57) RepID=L0M0Z1_ENTBF
Length=450

 Score =  856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/449 (92%), Positives = 429/449 (95%), Gaps = 0/449 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KL+LEDGTQLVVPPAFRREIYRELGISLYS+EAAEEAGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLELEDGTQLVVPPAFRREIYRELGISLYSDEAAEEAGLRWAQHYEFLSQQMATQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKG+IPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGMIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIET L  G I ++MHPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETDLQAGEILLRMHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVED+GPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG+L
Sbjct  361  GSELNRAWFQVEDNGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKE  449
            E+ TSERGGL IRAWLPVPV    G  KE
Sbjct  421  EIDTSERGGLLIRAWLPVPVAHVHGPVKE  449


> UniRef100_W6J586 Osmolarity sensor protein n=1 Tax=Enterobacter 
sacchari SP1 RepID=W6J586_9ENTR
Length=450

 Score =  855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/450 (92%), Positives = 430/450 (95%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R+RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MMRVRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAAL+VGKG IPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALKVGKGHIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM+E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+A+
Sbjct  241  VSHDLRTPLTRIRLATEMMAEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEVAE  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI+T L    I V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIDTGLKESEIFVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NRAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRIVDNHNG+L
Sbjct  361  GTEHNRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIVDNHNGIL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            ELGTSERGGL IRAWLP+P+ R  G  KE 
Sbjct  421  ELGTSERGGLCIRAWLPIPIARLSGQNKEA  450


> UniRef100_R9VRP7 Osmolarity sensor protein n=1 Tax=Enterobacter 
sp. R4-368 RepID=R9VRP7_9ENTR
Length=450

 Score =  855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/449 (92%), Positives = 430/449 (95%), Gaps = 0/449 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R+RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MMRVRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAAL+VGKG IPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALKVGKGHIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM+E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+A+
Sbjct  241  VSHDLRTPLTRIRLATEMMAEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEVAE  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI+T L    I V+MHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIDTGLKESEIFVRMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NRAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRIVDNHNG+L
Sbjct  361  GTEHNRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIVDNHNGIL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKE  449
            ELGTSERGGL IRAWLP+P+ R  G  KE
Sbjct  421  ELGTSERGGLCIRAWLPIPIARLSGQNKE  449


> UniRef100_V5AVK0 Osmolarity sensor protein envZ n=1 Tax=Enterobacter 
cloacae S611 RepID=V5AVK0_ENTCL
Length=450

 Score =  854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/449 (92%), Positives = 428/449 (95%), Gaps = 0/449 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MMRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAAL+VGKG IPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALKVGKGQIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEAAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI+T L  G I V+MHPLSIKRAVANMVVNAARYGNGWI+VSS
Sbjct  301  LNAVLGEVIAAESGYEREIDTGLQEGEIIVRMHPLSIKRAVANMVVNAARYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NRAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRIVDNHNG+L
Sbjct  361  GTELNRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIVDNHNGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKE  449
            ELGTSERGGL IRAWLP+PV R  G  KE
Sbjct  421  ELGTSERGGLCIRAWLPIPVVRQNGQLKE  449


> UniRef100_H3N490 Osmolarity sensor protein envZ n=1 Tax=Klebsiella 
oxytoca 10-5250 RepID=H3N490_KLEOX
Length=453

 Score =  854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/448 (92%), Positives = 430/448 (95%), Gaps = 0/448 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+ D
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELTD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI T L PG I +++HPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATDLQPGEIPLRVHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQR+HLFQPFVRGDSARTISGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEGNRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARTISGTGLGLAIVQRIIDNHNGKL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTK  448
            ELG+SERGGL IRAWLPVP+ RA    K
Sbjct  421  ELGSSERGGLLIRAWLPVPMNRALPAVK  448


> UniRef100_H3LEF2 Osmolarity sensor protein envZ n=4 Tax=Klebsiella 
RepID=H3LEF2_KLEOX
Length=453

 Score =  852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/443 (93%), Positives = 429/443 (96%), Gaps = 0/443 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+ D
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELTD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI T L PG I +++HPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATDLQPGEIPLRVHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQR+HLFQPFVRGDSARTISGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEGNRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARTISGTGLGLAIVQRIIDNHNGKL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRA  443
            ELG+SERGGL IRAWLPVP+ RA
Sbjct  421  ELGSSERGGLLIRAWLPVPMQRA  443


> UniRef100_G8W720 Osmolarity sensor protein n=3 Tax=Klebsiella 
oxytoca RepID=G8W720_KLEOK
Length=453

 Score =  852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/443 (93%), Positives = 429/443 (96%), Gaps = 0/443 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+ D
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELTD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI T L PG I +++HPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATDLQPGEIPLRVHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQR+HLFQPFVRGDSARTISGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEGNRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARTISGTGLGLAIVQRIIDNHNGKL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRA  443
            ELG+SERGGL IRAWLPVP+ RA
Sbjct  421  ELGSSERGGLLIRAWLPVPMQRA  443


> UniRef100_I6XAH1 Osmolarity sensory histidine kinase EnvZ n=1 
Tax=Klebsiella oxytoca E718 RepID=I6XAH1_KLEOX
Length=453

 Score =  850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/443 (93%), Positives = 428/443 (96%), Gaps = 0/443 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+ D
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELTD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI T L PG I +++HPLSIKRA+ NMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATDLQPGEIPLRVHPLSIKRALTNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQR+HLFQPFVRGDSARTISGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEGNRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARTISGTGLGLAIVQRIIDNHNGKL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRA  443
            ELG+SERGGL IRAWLPVP+ RA
Sbjct  421  ELGSSERGGLLIRAWLPVPMQRA  443


> UniRef100_A0A022H9D9 Osmolarity sensor protein envZ n=7 Tax=Klebsiella 
oxytoca RepID=A0A022H9D9_KLEOX
Length=453

 Score =  850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/448 (92%), Positives = 430/448 (95%), Gaps = 0/448 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMP+E+ D
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPVELVD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI T L PG I +++HPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATDLQPGEIPLRVHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQR+HLFQPFVRGDSARTISGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEGNRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARTISGTGLGLAIVQRIIDNHNGKL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTK  448
            ELG+SERGGL IRAWLPVP+ RA    K
Sbjct  421  ELGSSERGGLLIRAWLPVPMHRALPAVK  448


> UniRef100_K6KRA4 Osmolarity sensor protein n=1 Tax=Klebsiella 
oxytoca M5al RepID=K6KRA4_KLEOX
Length=453

 Score =  847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/448 (91%), Positives = 427/448 (95%), Gaps = 0/448 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRP  DLEHAALQVG+G IPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPPFDLEHAALQVGRGFIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+ D
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELTD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI T L PG I +++HPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATDLQPGEIPLRVHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI PEQR+HLFQPFVRGDSARTISGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEGNRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARTISGTGLGLAIVQRIIDNHNGKL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTK  448
            ELG+SERGGL IRAWLPVP+ RA    K
Sbjct  421  ELGSSERGGLLIRAWLPVPMNRALPAVK  448


> UniRef100_G5LUR5 Osmolarity sensory histidine kinase EnvZ n=1 
Tax=Salmonella enterica subsp. enterica serovar Alachua str. 
R6-377 RepID=G5LUR5_SALET
Length=429

 Score =  847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/429 (95%), Positives = 418/429 (97%), Gaps = 0/429 (0%)

Query  22   LLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIY  81
            +LF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIY
Sbjct  1    MLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIY  60

Query  82   RELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSP  141
            RELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSP
Sbjct  61   RELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSP  120

Query  142  NIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGII  201
            NIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGII
Sbjct  121  NIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGII  180

Query  202  PPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSE  261
            PPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMM E
Sbjct  181  PPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMGE  240

Query  262  QDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIET  321
            +DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLN+VLGEVIAAESGYEREI T
Sbjct  241  EDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNSVLGEVIAAESGYEREINT  300

Query  322  ALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPE  381
            AL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE +RAWFQVEDDGPGI PE
Sbjct  301  ALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTESHRAWFQVEDDGPGIKPE  360

Query  382  QRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVT  441
            QRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGMLE+GTSERGGLSIRAWLPVPV 
Sbjct  361  QRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGMLEIGTSERGGLSIRAWLPVPVA  420

Query  442  RAQGTTKEG  450
            R QGTTKE 
Sbjct  421  RVQGTTKEA  429


> UniRef100_G0E6C9 Osmolarity sensor protein n=9 Tax=Enterobacteriaceae 
RepID=G0E6C9_ENTAK
Length=453

 Score =  847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/448 (91%), Positives = 427/448 (95%), Gaps = 0/448 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI T L  G I +++HPLSIKRA+ANMVVNAARYG GWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATDLQAGEIPLRLHPLSIKRALANMVVNAARYGKGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E +RAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTK  448
            E+GTSERGGL IRAWLP+PV RA    K
Sbjct  421  EIGTSERGGLLIRAWLPIPVHRALSPAK  448


> UniRef100_K8BCC7 Osmolarity sensory histidine kinase EnvZ n=1 
Tax=Cronobacter turicensis 564 RepID=K8BCC7_9ENTR
Length=448

 Score =  845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/447 (92%), Positives = 428/447 (95%), Gaps = 4/447 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MR+LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRKLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYLAESINKDIEECNAIIEQFIDYLRTGQEMP+E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEGDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPLETAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIA+ESGYEREIETAL  G I +++HPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIASESGYEREIETALQSGEIPLRIHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NRAWFQVEDDGPGI P Q KHL QPFVRGDSAR+ SGTGLGLAIVQRI+DNH+G+L
Sbjct  361  GTELNRAWFQVEDDGPGIDPAQLKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDNHHGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTT  447
            ++G SERGGL IRAWLPVPV    GTT
Sbjct  421  DIGKSERGGLRIRAWLPVPV----GTT  443


> UniRef100_J0MGX4 Osmolarity sensor protein n=1 Tax=Enterobacter 
sp. Ag1 RepID=J0MGX4_9ENTR
Length=449

 Score =  845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/442 (92%), Positives = 426/442 (96%), Gaps = 0/442 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM ++DGYLAESINKDIEECNAIIEQFIDYLRTGQEMP+EMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGQEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPLEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN VLGEVIAAESGYEREI+T L  G I + +HPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNGVLGEVIAAESGYEREIDTDLQAGEIRLNIHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI P+Q +HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GSELNRAWFQVEDDGPGIEPDQLQHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTR  442
            +LG SERGGL IRA+LP+P+TR
Sbjct  421  DLGKSERGGLRIRAYLPLPITR  442


> UniRef100_K8A9J3 Osmolarity sensory histidine kinase EnvZ n=1 
Tax=Cronobacter muytjensii 530 RepID=K8A9J3_9ENTR
Length=448

 Score =  845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/443 (93%), Positives = 426/443 (96%), Gaps = 0/443 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MR+LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRKLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYANEAAEEAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYLAESINKDIEECNAIIEQFIDYLRTGQEMP+E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEGDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPLETAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIA+ESGYEREIETAL  G I +++HPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIASESGYEREIETALQSGEIPLRIHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NRAWFQVEDDGPGI P Q KHL QPFVRGDSAR+ SGTGLGLAIVQRI+DNH+G+L
Sbjct  361  GTELNRAWFQVEDDGPGIEPSQLKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDNHHGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRA  443
            ++G SERGGL IRAWLPVPV  A
Sbjct  421  DIGKSERGGLRIRAWLPVPVGTA  443


> UniRef100_M9W438 Osmolarity sensor protein n=4 Tax=Enterobacteriaceae 
RepID=M9W438_RAOOR
Length=453

 Score =  845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/449 (91%), Positives = 429/449 (95%), Gaps = 0/449 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI T L  G I +++HPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREIATDLQAGEIPLRIHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E + AWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEASSAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKE  449
            E+G+SERGGL IRAWLPVPV RA   TK+
Sbjct  421  EIGSSERGGLLIRAWLPVPVQRALTPTKQ  449


> UniRef100_W9BBZ6 EnvZ protein n=186 Tax=Enterobacteriaceae RepID=W9BBZ6_KLEPN
Length=451

 Score =  845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/438 (93%), Positives = 424/438 (96%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI TAL  G I V+MHPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATALQAGEIPVRMHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E +RAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G+SERGGL IRAWLPV
Sbjct  421  EIGSSERGGLLIRAWLPV  438


> UniRef100_B5XTT3 Osmolarity sensor protein EnvZ n=2 Tax=Klebsiella 
pneumoniae RepID=B5XTT3_KLEP3
Length=451

 Score =  845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/438 (93%), Positives = 424/438 (96%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI TAL  G I V+MHPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATALQAGEIPVRMHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E +RAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G+SERGGL IRAWLPV
Sbjct  421  EIGSSERGGLLIRAWLPV  438


> UniRef100_UPI0003694DA7 osmolarity sensor protein n=1 Tax=Klebsiella 
pneumoniae RepID=UPI0003694DA7
Length=451

 Score =  845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/438 (93%), Positives = 424/438 (96%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI TAL  G I V+MHPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATALQAGEIPVRMHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E +RAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G+SERGGL IRAWLPV
Sbjct  421  EIGSSERGGLLIRAWLPV  438


> UniRef100_M7PRU3 Osmolarity sensor protein n=3 Tax=Klebsiella 
RepID=M7PRU3_KLEPN
Length=451

 Score =  845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/438 (93%), Positives = 424/438 (96%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI TAL  G I V+MHPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATALQAGEIPVRMHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E +RAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G+SERGGL IRAWLPV
Sbjct  421  EIGSSERGGLLIRAWLPV  438


> UniRef100_G0GLG7 Osmolarity sensor protein n=15 Tax=Enterobacteriaceae 
RepID=G0GLG7_KLEPN
Length=451

 Score =  845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/438 (93%), Positives = 424/438 (96%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI TAL  G I V+MHPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATALQAGEIPVRMHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E +RAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G+SERGGL IRAWLPV
Sbjct  421  EIGSSERGGLLIRAWLPV  438


> UniRef100_D3RE41 Integral membrane sensor signal transduction 
histidine kinase n=7 Tax=Klebsiella RepID=D3RE41_KLEVT
Length=451

 Score =  845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/438 (93%), Positives = 424/438 (96%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI TAL  G I V+MHPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATALQAGEIPVRMHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E +RAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G+SERGGL IRAWLPV
Sbjct  421  EIGSSERGGLLIRAWLPV  438


> UniRef100_I6CB19 Osmolarity sensor protein envZ n=1 Tax=Shigella 
flexneri K-315 RepID=I6CB19_SHIFL
Length=411

 Score =  845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/411 (99%), Positives = 411/411 (100%), Gaps = 0/411 (0%)

Query  40   LPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGL  99
            +PSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGL
Sbjct  1    MPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGL  60

Query  100  RWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSP  159
            RWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSP
Sbjct  61   RWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSP  120

Query  160  LFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRA  219
            LFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRA
Sbjct  121  LFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRA  180

Query  220  FNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNA  279
            FNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNA
Sbjct  181  FNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNA  240

Query  280  IIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKR  339
            IIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKR
Sbjct  241  IIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKR  300

Query  340  AVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTI  399
            AVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTI
Sbjct  301  AVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTI  360

Query  400  SGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            SGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Sbjct  361  SGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKEG  411


> UniRef100_S3ILA2 Osmolarity sensor protein EnvZ n=1 Tax=Cedecea 
davisae DSM 4568 RepID=S3ILA2_9ENTR
Length=449

 Score =  845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/442 (92%), Positives = 426/442 (96%), Gaps = 0/442 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM ++DGYLAESINKDIEECNAIIEQFIDYLRTGQEMP+EMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGQEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPLEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI+T L  G I + +HPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREIDTDLMDGEIRLNIHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E NRAWFQVEDDGPGI P+Q +HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNGML
Sbjct  361  GSELNRAWFQVEDDGPGIEPDQLQHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML  420

Query  421  ELGTSERGGLSIRAWLPVPVTR  442
            +LG SERGGL IRA+LP+P+ R
Sbjct  421  DLGKSERGGLRIRAYLPLPIVR  442


> UniRef100_K8B4P8 Osmolarity sensory histidine kinase EnvZ n=1 
Tax=Cronobacter dublinensis 1210 RepID=K8B4P8_9ENTR
Length=448

 Score =  845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/440 (93%), Positives = 425/440 (96%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MR+LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRKLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYANEAAEEAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYLAESINKDIEECNAIIEQFIDYLRTGQEMP+E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEGDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPLETAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIA+ESGYEREIETAL  G I +++HPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIASESGYEREIETALQSGEIPLRIHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NRAWFQVEDDGPGI P Q KHL QPFVRGDSAR+ SGTGLGLAIVQRI+DNH+G+L
Sbjct  361  GTELNRAWFQVEDDGPGIEPSQLKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDNHHGLL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            ++G SERGGL IRAWLPVPV
Sbjct  421  DIGKSERGGLRIRAWLPVPV  440


> UniRef100_C9Y288 Osmolarity sensor protein envZ n=1 Tax=Cronobacter 
turicensis (strain DSM 18703 / LMG 23827 / z3032) RepID=C9Y288_CROTZ
Length=448

 Score =  845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/447 (92%), Positives = 428/447 (95%), Gaps = 4/447 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MR+LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRKLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYANEAAEEAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYLAESINKDIEECNAIIEQFIDYLRTGQEMP+E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEGDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPLETAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIA+ESGYEREIETAL  G I +++HPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIASESGYEREIETALQTGEIPLRIHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NRAWFQVEDDGPGI P Q KHL QPFVRGDSAR+ SGTGLGLAIVQRI+DNH+G+L
Sbjct  361  GTELNRAWFQVEDDGPGIDPAQLKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDNHHGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTT  447
            ++G SERGGL IRAWLPVPV    GTT
Sbjct  421  DIGKSERGGLRIRAWLPVPV----GTT  443


> UniRef100_W8Y5R3 Sensory histidine kinase in two-component regulatory 
system with OmpR n=1 Tax=Klebsiella sp. 18A069 RepID=W8Y5R3_9ENTR
Length=451

 Score =  844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/438 (93%), Positives = 424/438 (96%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMP+E+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPLELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI TAL  G I V+MHPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATALQAGEIPVRMHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E +RAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G+SERGGL IRAWLPV
Sbjct  421  EIGSSERGGLLIRAWLPV  438


> UniRef100_F3QDA1 Osmolarity sensor protein EnvZ n=5 Tax=Bacteria 
RepID=F3QDA1_9ENTR
Length=451

 Score =  843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/438 (93%), Positives = 424/438 (96%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI TAL  G I V+MHPLSIKRA+ANMVVNAARYGNGWI+VSS
Sbjct  301  LNAVLGEVIAAESGYEREIATALQAGEIPVRMHPLSIKRALANMVVNAARYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E +RAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G+SERGGL IRAWLPV
Sbjct  421  EIGSSERGGLLIRAWLPV  438


> UniRef100_V3D397 Osmolarity sensor protein envZ n=1 Tax=Klebsiella 
pneumoniae UCICRE 14 RepID=V3D397_KLEPN
Length=451

 Score =  843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/438 (93%), Positives = 424/438 (96%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMP+E+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPLELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI TAL  G I V+MHPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATALQAGEIPVRMHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E +RAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G+SERGGL IRAWLPV
Sbjct  421  EIGSSERGGLLIRAWLPV  438


> UniRef100_Y1EMS9 Osmolarity sensor protein envZ n=2 Tax=Enterobacter 
aerogenes RepID=Y1EMS9_ENTAE
Length=453

 Score =  843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/448 (91%), Positives = 426/448 (95%), Gaps = 0/448 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLN+AILPSLQQFNKVLAYE RMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNYAILPSLQQFNKVLAYEFRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI T L  G I +++HPLSIKRA+ANMVVNAARYG GWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATDLQAGEIPLRLHPLSIKRALANMVVNAARYGKGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E +RAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTK  448
            E+GTSERGGL IRAWLP+PV RA    K
Sbjct  421  EIGTSERGGLLIRAWLPIPVHRALSPAK  448


> UniRef100_K8A019 Osmolarity sensory histidine kinase EnvZ n=1 
Tax=Cronobacter condimenti 1330 RepID=K8A019_9ENTR
Length=448

 Score =  843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/443 (93%), Positives = 425/443 (95%), Gaps = 0/443 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MR+LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRKLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KL LEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLLLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYLAESINKDIEECNAIIEQFIDYLRTGQEMP+E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEGDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPLETAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIA+ESGYEREIETAL  G I +++HPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIASESGYEREIETALQSGEIPLRIHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NRAWFQVEDDGPGI P Q KHL QPFVRGDSAR+ SGTGLGLAIVQRIVDNH+G+L
Sbjct  361  GTELNRAWFQVEDDGPGIEPSQLKHLLQPFVRGDSARSTSGTGLGLAIVQRIVDNHHGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRA  443
            ++G SERGGL IRAWLPVPV  A
Sbjct  421  DIGKSERGGLRIRAWLPVPVGTA  443


> UniRef100_K8DGS3 Osmolarity sensory histidine kinase EnvZ n=1 
Tax=Cronobacter universalis NCTC 9529 RepID=K8DGS3_9ENTR
Length=448

 Score =  843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/447 (92%), Positives = 427/447 (95%), Gaps = 4/447 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MR+LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRKLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYANEAAEEAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYLAESINKDIEECN IIEQFIDYLRTGQEMP+E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEGDGYLAESINKDIEECNDIIEQFIDYLRTGQEMPLETAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIA+ESGYEREIETAL  G I +++HPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIASESGYEREIETALQSGEIPLRIHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NRAWFQVEDDGPGI P Q KHL QPFVRGDSAR+ SGTGLGLAIVQRI+DNH+G+L
Sbjct  361  GTELNRAWFQVEDDGPGIEPAQLKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDNHHGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTT  447
            ++G SERGGL IRAWLPVPV    GTT
Sbjct  421  DIGKSERGGLRIRAWLPVPV----GTT  443


> UniRef100_V5TVS7 Osmolarity sensor protein n=3 Tax=Cronobacter 
RepID=V5TVS7_CROSK
Length=448

 Score =  842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/443 (92%), Positives = 425/443 (95%), Gaps = 0/443 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MR+LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRKLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYANEAAEEAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYLAESINKDIEECN IIEQFIDYLRTGQEMP+E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEGDGYLAESINKDIEECNDIIEQFIDYLRTGQEMPLETAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIA+ESGYEREIETAL  G I +++HPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIASESGYEREIETALQSGEIPLRIHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NRAWFQVEDDGPGI P Q KHL QPFVRGDSAR+ SGTGLGLAIVQRI+DNH+G+L
Sbjct  361  GTELNRAWFQVEDDGPGIEPAQLKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDNHHGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRA  443
            ++G SERGGL IRAWLPVPV  A
Sbjct  421  DIGKSERGGLRIRAWLPVPVGTA  443


> UniRef100_M5SV67 Osmolarity sensor protein envZ n=1 Tax=Klebsiella 
pneumoniae VA360 RepID=M5SV67_KLEPN
Length=451

 Score =  842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/438 (93%), Positives = 423/438 (96%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAF REIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFCREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI TAL  G I V+MHPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATALQAGEIPVRMHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E +RAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G+SERGGL IRAWLPV
Sbjct  421  EIGSSERGGLLIRAWLPV  438


> UniRef100_I5ZG41 Protein histidine kinase/phosphatase sensor 
for OmpR, modulates expression of ompF and ompC n=3 Tax=Escherichia 
coli RepID=I5ZG41_ECOLX
Length=411

 Score =  842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/411 (99%), Positives = 410/411 (99%), Gaps = 0/411 (0%)

Query  40   LPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGL  99
            +PSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGL
Sbjct  1    MPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGL  60

Query  100  RWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSP  159
            RWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSP
Sbjct  61   RWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSP  120

Query  160  LFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRA  219
            LFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRA
Sbjct  121  LFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRA  180

Query  220  FNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNA  279
            FNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNA
Sbjct  181  FNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNA  240

Query  280  IIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKR  339
            IIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKR
Sbjct  241  IIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKR  300

Query  340  AVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTI  399
            AVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTI
Sbjct  301  AVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTI  360

Query  400  SGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            SGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQ TTKEG
Sbjct  361  SGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQSTTKEG  411


> UniRef100_Z5G3Z7 Osmolarity sensor protein envZ n=1 Tax=Klebsiella 
pneumoniae BIDMC 47 RepID=Z5G3Z7_KLEPN
Length=451

 Score =  842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/438 (93%), Positives = 423/438 (96%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI TAL  G I V+MHPLSIKRA+ANMVVNAA YGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATALQAGEIPVRMHPLSIKRALANMVVNAAGYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E +RAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G+SERGGL IRAWLPV
Sbjct  421  EIGSSERGGLLIRAWLPV  438


> UniRef100_A7MGC8 Uncharacterized protein n=7 Tax=Cronobacter 
sakazakii RepID=A7MGC8_CROS8
Length=448

 Score =  842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/447 (92%), Positives = 427/447 (95%), Gaps = 4/447 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MR+LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRKLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYANEAAEEAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYLAESINKDIEECN IIEQFIDYLRTGQEMP+E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEGDGYLAESINKDIEECNDIIEQFIDYLRTGQEMPLETAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIA+ESGYEREIETAL  G I +++HPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIASESGYEREIETALQSGEIPLRIHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NRAWFQVEDDGPGI P Q KHL QPFVRGDSAR+ SGTGLGLAIVQRI+DNH+G+L
Sbjct  361  GTELNRAWFQVEDDGPGIEPAQLKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDNHHGLL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTT  447
            ++G SERGGL IRAWLPVPV    GTT
Sbjct  421  DIGKSERGGLRIRAWLPVPV----GTT  443


> UniRef100_Z5I8D2 Osmolarity sensor protein envZ n=1 Tax=Klebsiella 
pneumoniae BIDMC 35 RepID=Z5I8D2_KLEPN
Length=451

 Score =  842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/438 (93%), Positives = 423/438 (96%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAI LLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIRLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI TAL  G I V+MHPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATALQAGEIPVRMHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E +RAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G+SERGGL IRAWLPV
Sbjct  421  EIGSSERGGLLIRAWLPV  438


> UniRef100_Z5PVK5 Osmolarity sensor protein envZ n=1 Tax=Klebsiella 
pneumoniae BWH 41 RepID=Z5PVK5_KLEPN
Length=451

 Score =  842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/438 (93%), Positives = 423/438 (96%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRVRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVR PLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRGPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREI TAL  G I V+MHPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIATALQAGEIPVRMHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E +RAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GSEASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G+SERGGL IRAWLPV
Sbjct  421  EIGSSERGGLLIRAWLPV  438


> UniRef100_R4Y8F9 EnvZ protein n=1 Tax=Klebsiella pneumoniae RepID=R4Y8F9_KLEPN
Length=448

 Score =  840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/435 (93%), Positives = 421/435 (96%), Gaps = 0/435 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMA QLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAHQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPME+ADLNA
Sbjct  241  DLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMELADLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIAAESGYEREI TAL  G I V+MHPLSIKRA+ANMVVNAARYGNGWIKVSSG+E
Sbjct  301  VLGEVIAAESGYEREIATALQAGEIPVRMHPLSIKRALANMVVNAARYGNGWIKVSSGSE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
             +RAWFQVEDDGPGI PEQR+HLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG LE+G
Sbjct  361  ASRAWFQVEDDGPGIKPEQREHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGRLEIG  420

Query  424  TSERGGLSIRAWLPV  438
            +SERGGL IRAWLPV
Sbjct  421  SSERGGLLIRAWLPV  435


> UniRef100_H5V3D5 Osmolarity two-component histidine kinase EnvZ 
n=1 Tax=Escherichia hermannii NBRC 105704 RepID=H5V3D5_ESCHE
Length=452

 Score =  840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/451 (91%), Positives = 424/451 (94%), Gaps = 2/451 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+RLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAE+AGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEDAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMP+EM D
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPLEMTD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIET L  G I V +HPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIETDLQHGEIMVNIHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NR WFQVEDDGPGI PEQ KHL QPFVRGDSAR+ SGTGLGLAIVQRI+DNHNG L
Sbjct  361  GTELNRGWFQVEDDGPGIKPEQLKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGAL  420

Query  421  ELGTSERGGLSIRAWL--PVPVTRAQGTTKE  449
            ++G S RGGL IRAWL  PVPVTR     +E
Sbjct  421  DIGRSARGGLRIRAWLPVPVPVTRQHHPMRE  451


> UniRef100_L1FE87 Osmolarity sensor protein envZ n=1 Tax=Escherichia 
coli 97.1742 RepID=L1FE87_ECOLX
Length=435

 Score =  835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/408 (100%), Positives = 408/408 (100%), Gaps = 0/408 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAI  408
            GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAI
Sbjct  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAI  408


> UniRef100_I2B4A7 Osmolarity sensor protein EnvZ n=1 Tax=Shimwellia 
blattae (strain ATCC 29907 / DSM 4481 / JCM 1650 / NBRC 
105725 / CDC 9005-74) RepID=I2B4A7_SHIBC
Length=453

 Score =  828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/438 (92%), Positives = 419/438 (95%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLYS+EAAEEAGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSDEAAEEAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKT LSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTSLSPSIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMP+E  D
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPVERTD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN VLGEVIA+ESGYEREIET L  G I V +HPLS+KRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNMVLGEVIASESGYEREIETGLQNGEIMVDIHPLSVKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NRAWFQVEDDGPGI+P+Q +HL QPFVRGDSAR+ SGTGLGLAIVQRIVDNH GML
Sbjct  361  GTELNRAWFQVEDDGPGISPDQLQHLLQPFVRGDSARSTSGTGLGLAIVQRIVDNHRGML  420

Query  421  ELGTSERGGLSIRAWLPV  438
            ++G+S++GGL IRAWLP+
Sbjct  421  DIGSSDKGGLRIRAWLPL  438


> UniRef100_UPI000369214D osmolarity sensor protein n=1 Tax=Enterobacteriaceae 
bacterium LSJC7 RepID=UPI000369214D
Length=451

 Score =  827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/449 (90%), Positives = 422/449 (93%), Gaps = 0/449 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KL LEDGTQLVVPPAFRREIYRELGISLYS+EAAEEAGLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLLLEDGTQLVVPPAFRREIYRELGISLYSDEAAEEAGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEH A+QVGKGIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHVAIQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFID+LRTGQEMP+E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDFLRTGQEMPLESAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIA+ESGYEREIET L PG I +++HPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIASESGYEREIETELKPGEIPLQIHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE NRAWFQV+DDGPGI P Q  HL QPFVRGDSART SGTGLGLAIVQRIV+NH+G L
Sbjct  361  GTELNRAWFQVDDDGPGIEPSQLAHLLQPFVRGDSARTTSGTGLGLAIVQRIVNNHHGAL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKE  449
            ++  SERGGLSIRAWLP+   R   + KE
Sbjct  421  DISRSERGGLSIRAWLPMQPVRPGVSRKE  449


> UniRef100_X3X8B7 Osmolarity sensor protein (Fragment) n=1 Tax=Salmonella 
enterica subsp. enterica serovar Enteritidis str. 
EC20121541 RepID=X3X8B7_SALEN
Length=417

 Score =  821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/417 (95%), Positives = 406/417 (97%), Gaps = 0/417 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
Sbjct  61   KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAI   AIGGAWLFIR
Sbjct  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIXXXAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHN  417
            GTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ SGTGLGLAIVQRI+DNHN
Sbjct  361  GTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHN  417


> UniRef100_K6WM72 Osmolarity two-component histidine kinase EnvZ 
n=1 Tax=Shimwellia blattae (strain ATCC 29907 / DSM 4481 
/ JCM 1650 / NBRC 105725 / CDC 9005-74) RepID=K6WM72_SHIBC
Length=450

 Score =  820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/435 (91%), Positives = 416/435 (95%), Gaps = 0/435 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQLVVPPAFRREIYRELGISLYS+EAAEEAGLRWAQHYEFLS QMAQQLGGPTEVR
Sbjct  61   LEDGTQLVVPPAFRREIYRELGISLYSDEAAEEAGLRWAQHYEFLSQQMAQQLGGPTEVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNKSSPVVWLKT LSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKSSPVVWLKTSLSPSIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMP+E  DLN 
Sbjct  241  DLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPVERTDLNM  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEVIA+ESGYEREIET L  G I V +HPLS+KRAVANMVVNAARYGNGWIKVSSGTE
Sbjct  301  VLGEVIASESGYEREIETGLQNGEIMVDIHPLSVKRAVANMVVNAARYGNGWIKVSSGTE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
             NRAWFQVEDDGPGI+P+Q +HL QPFVRGDSAR+ SGTGLGLAIVQRIVDNH GML++G
Sbjct  361  LNRAWFQVEDDGPGISPDQLQHLLQPFVRGDSARSTSGTGLGLAIVQRIVDNHRGMLDIG  420

Query  424  TSERGGLSIRAWLPV  438
            +S++GGL IRAWLP+
Sbjct  421  SSDKGGLRIRAWLPL  435


> UniRef100_E6WH04 Integral membrane sensor signal transduction 
histidine kinase n=1 Tax=Pantoea sp. (strain At-9b) RepID=E6WH04_PANSA
Length=452

 Score =  815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/441 (90%), Positives = 416/441 (94%), Gaps = 0/441 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYEFLSEQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE+DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE A+ P  + + ++PLSIKRAVAN+VVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIENAVMPEELMLDINPLSIKRAVANLVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E NRAWFQVEDDGPGI PEQ +HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GQELNRAWFQVEDDGPGIKPEQLQHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHEGSL  420

Query  421  ELGTSERGGLSIRAWLPVPVT  441
            E+G SERGGL IRAWLPVP T
Sbjct  421  EIGVSERGGLRIRAWLPVPGT  441


> UniRef100_B5BHF9 Two-component sensor kinase EnvZ n=6 Tax=Salmonella 
enterica I RepID=B5BHF9_SALPK
Length=411

 Score =  813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/410 (95%), Positives = 401/410 (97%), Gaps = 0/410 (0%)

Query  40   LPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGL  99
            +PSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGL
Sbjct  1    MPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGL  60

Query  100  RWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSP  159
            RWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSP
Sbjct  61   RWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSP  120

Query  160  LFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRA  219
            LFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRA
Sbjct  121  LFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRA  180

Query  220  FNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNA  279
            FNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNA
Sbjct  181  FNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNA  240

Query  280  IIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKR  339
            IIEQFIDYLRTGQEMPMEMADLN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKR
Sbjct  241  IIEQFIDYLRTGQEMPMEMADLNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKR  300

Query  340  AVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTI  399
            AVANMVVNAARYGNGWIKVSSGTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ 
Sbjct  301  AVANMVVNAARYGNGWIKVSSGTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARST  360

Query  400  SGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKE  449
            SGTGLGLAIVQRI+DNHNGMLE+GTSERGGLSIRAWLPVPV R QGTTKE
Sbjct  361  SGTGLGLAIVQRIIDNHNGMLEIGTSERGGLSIRAWLPVPVARVQGTTKE  410


> UniRef100_B5R7L3 Two-component sensor kinase EnvZ n=1 Tax=Salmonella 
gallinarum (strain 287/91 / NCTC 13346) RepID=B5R7L3_SALG2
Length=411

 Score =  810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/411 (94%), Positives = 399/411 (97%), Gaps = 0/411 (0%)

Query  40   LPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGL  99
            +PSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLY+NEAAEEAGL
Sbjct  1    MPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGL  60

Query  100  RWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSP  159
            RWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSP
Sbjct  61   RWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSP  120

Query  160  LFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRA  219
            LFRYTLAIMLLAIGG WLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRA
Sbjct  121  LFRYTLAIMLLAIGGVWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRA  180

Query  220  FNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNA  279
            FNHMAA VKQLADDRTLLMAGVSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNA
Sbjct  181  FNHMAASVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNA  240

Query  280  IIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKR  339
            IIEQFIDYLRTGQEMPMEMADLN+VLGEVIAAESGYEREI TAL  GSI+VKMHPLSIKR
Sbjct  241  IIEQFIDYLRTGQEMPMEMADLNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKR  300

Query  340  AVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTI  399
            AVANMVVNAARYGNGWIKVSSGTE +RAWFQVEDDGPGI PEQRKHLFQPFVRGDSAR+ 
Sbjct  301  AVANMVVNAARYGNGWIKVSSGTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARST  360

Query  400  SGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            SGTGLGLAIVQRI+DNHNGMLE+GTSERGGLSIRAWLPVPV R QGTTKE 
Sbjct  361  SGTGLGLAIVQRIIDNHNGMLEIGTSERGGLSIRAWLPVPVARVQGTTKEA  411


> UniRef100_U2M5C8 Osmolarity sensory histidine kinase EnvZ n=1 
Tax=Pantoea sp. AS-PWVM4 RepID=U2M5C8_9ENTR
Length=449

 Score =  808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/438 (89%), Positives = 414/438 (94%), Gaps = 0/438 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD+LQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQL VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMAQQLGGPT+VR
Sbjct  61   LEDGTQLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYEFLSEQMAQQLGGPTDVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMSE+DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E ADLN+
Sbjct  241  DLRTPLTRIRLATEMMSEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTERADLNS  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEV+AAESGYEREIE A+ P  + + ++PLSIKRAVAN+VVNAARYGNGWIKVSSG E
Sbjct  301  VLGEVVAAESGYEREIENAVMPEELILDINPLSIKRAVANLVVNAARYGNGWIKVSSGQE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
             NRAWFQVEDDGPGI PEQ +HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H+G LE+G
Sbjct  361  LNRAWFQVEDDGPGIKPEQLQHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHDGSLEIG  420

Query  424  TSERGGLSIRAWLPVPVT  441
             SERGGL IRAWLPVP T
Sbjct  421  VSERGGLRIRAWLPVPGT  438


> UniRef100_J3D257 Signal transduction histidine kinase n=1 Tax=Pantoea 
sp. GM01 RepID=J3D257_9ENTR
Length=454

 Score =  807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/439 (88%), Positives = 412/439 (93%), Gaps = 0/439 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QM QQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYEFLSEQMGQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE A+    + + ++PLSIKRA+AN+VVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIENAVMSEDVMLDINPLSIKRALANLVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E NRAWFQVEDDGPGI P+Q +HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GKELNRAWFQVEDDGPGIKPDQLQHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHEGSL  420

Query  421  ELGTSERGGLSIRAWLPVP  439
            E+G S+RGGL IRAWLP+P
Sbjct  421  EIGESDRGGLRIRAWLPIP  439


> UniRef100_J2UPM2 Signal transduction histidine kinase n=1 Tax=Pantoea 
sp. YR343 RepID=J2UPM2_9ENTR
Length=454

 Score =  806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/439 (88%), Positives = 412/439 (93%), Gaps = 0/439 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QM QQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYEFLSEQMGQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE A+    + + ++PLSIKRA+AN+VVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIENAVMSEDLMLDINPLSIKRALANLVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E NRAWFQVEDDGPGI P+Q +HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GKELNRAWFQVEDDGPGIKPDQLQHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHEGSL  420

Query  421  ELGTSERGGLSIRAWLPVP  439
            E+G S+RGGL IRAWLP+P
Sbjct  421  EIGDSDRGGLRIRAWLPIP  439


> UniRef100_UPI0003717709 osmolarity sensor protein n=1 Tax=Pantoea 
sp. A4 RepID=UPI0003717709
Length=450

 Score =  805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/438 (89%), Positives = 412/438 (94%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AAEE GLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAAEEGGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGQGIIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE A+    + + ++PLSIKRAVAN+VVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIENAVMAEELMLNINPLSIKRAVANLVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E NRAWFQVEDDGPGI P+Q +HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GRELNRAWFQVEDDGPGIKPDQLQHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHQGAL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G S+RGGL IRAWLP+
Sbjct  421  EIGESDRGGLKIRAWLPL  438


> UniRef100_U1U1B2 Osmolarity sensor protein n=1 Tax=Pantoea dispersa 
EGD-AAK13 RepID=U1U1B2_9ENTR
Length=449

 Score =  804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/440 (88%), Positives = 412/440 (93%), Gaps = 0/440 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD+LQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQL VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMAQQLGGPT+VR
Sbjct  61   LEDGTQLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYEFLSEQMAQQLGGPTDVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E ADLN+
Sbjct  241  DLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTERADLNS  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEV+AAESGYEREIE A+    + + ++PLSIKRAVAN+VVNAARYGNGWIKVSSG E
Sbjct  301  VLGEVVAAESGYEREIENAVMDAELMLDINPLSIKRAVANLVVNAARYGNGWIKVSSGQE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
             NRAWFQVEDDGPGI P+Q +HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H+G LE+G
Sbjct  361  LNRAWFQVEDDGPGIKPDQLQHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHDGSLEIG  420

Query  424  TSERGGLSIRAWLPVPVTRA  443
             SERGGL IRAWLP+P   A
Sbjct  421  DSERGGLRIRAWLPIPENSA  440


> UniRef100_L7ZUE3 Sensory histidine kinase in two-component regulatory 
system with OmpR n=2 Tax=Serratia marcescens RepID=L7ZUE3_SERMA
Length=456

 Score =  804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/447 (86%), Positives = 415/447 (92%), Gaps = 0/447 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYQFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWL P+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEMP E +D
Sbjct  241  VSHDLRTPLTRIRLATEMMSAEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPTESSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+LGEV+AAESGYER IETAL PG + + +HPLSIKRA  NMVVNAARYGNGWIKVSS
Sbjct  301  LNAILGEVVAAESGYERVIETALSPGELMMNVHPLSIKRAAVNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  R WFQVEDDGPGI PE+ KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H+G L
Sbjct  361  GRELQRGWFQVEDDGPGIKPEELKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHDGEL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTT  447
            ++GTSERGGL IRA++P+P+ + + T 
Sbjct  421  DIGTSERGGLLIRAYIPLPMEKKESTN  447


> UniRef100_W0T1Q0 Sensory histidine kinase in two-component regulatory 
system with OmpR n=2 Tax=Serratia marcescens RepID=W0T1Q0_SERMA
Length=456

 Score =  803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/444 (87%), Positives = 414/444 (93%), Gaps = 0/444 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYQFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWL P+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEMP E +D
Sbjct  241  VSHDLRTPLTRIRLATEMMSAEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPTESSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+LGEV+AAESGYER IETAL PG + + +HPLSIKRA  NMVVNAARYGNGWIKVSS
Sbjct  301  LNAILGEVVAAESGYERVIETALSPGELMMNVHPLSIKRAAVNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  R WFQVEDDGPGI PE+ KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H+G L
Sbjct  361  GRELQRGWFQVEDDGPGIKPEELKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHDGEL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQ  444
            E+GTSERGGL IRA++P+P+ + +
Sbjct  421  EIGTSERGGLLIRAYIPLPMEKKE  444


> UniRef100_E1SGV0 Osmolarity sensor protein EnvZ n=1 Tax=Pantoea 
vagans (strain C9-1) RepID=E1SGV0_PANVC
Length=455

 Score =  803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/443 (88%), Positives = 414/443 (93%), Gaps = 0/443 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+RLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QM QQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYEFLSEQMGQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE A+ P  + + ++PLSIKRA+AN+VVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIENAVMPEELMLDINPLSIKRALANLVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E +RAWFQVEDDGPGI P+Q  HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GRELHRAWFQVEDDGPGIKPDQLAHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHQGSL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRA  443
            E+G SERGGL IRAWLP+  T A
Sbjct  421  EIGESERGGLRIRAWLPLVETMA  443


> UniRef100_H8DS34 Osmolarity sensor protein n=1 Tax=Pantoea sp. 
Sc1 RepID=H8DS34_9ENTR
Length=456

 Score =  803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/438 (89%), Positives = 412/438 (94%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QM QQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYEFLSEQMGQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE A+ P  + + ++PLSIKRA+AN+VVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIENAVMPEELMLDINPLSIKRALANLVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E +RAWFQVEDDGPGI P+Q  HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GRELHRAWFQVEDDGPGIKPDQLAHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHQGSL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G SERGGL IRAWLP+
Sbjct  421  EIGESERGGLRIRAWLPL  438


> UniRef100_X7FFU7 Osmolarity sensor protein envZ n=1 Tax=Serratia 
marcescens BIDMC 50 RepID=X7FFU7_SERMA
Length=456

 Score =  803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/447 (86%), Positives = 415/447 (92%), Gaps = 0/447 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYQFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWL P+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEMP E +D
Sbjct  241  VSHDLRTPLTRIRLATEMMSAEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPTESSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+LGEV+AAESGYER IETAL PG + + +HPLSIKRA  NMVVNAARYGNGWIKVSS
Sbjct  301  LNAILGEVVAAESGYERVIETALSPGELMMNVHPLSIKRAAVNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  R WFQVEDDGPGI P++ KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H+G L
Sbjct  361  GRELQRGWFQVEDDGPGIKPDELKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHDGEL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTT  447
            ++GTSERGGL IRA++P+P+ + + T 
Sbjct  421  DIGTSERGGLLIRAYIPLPMEKKESTN  447


> UniRef100_D2T9B6 Protein histidine kinase/phosphatase sensor 
for OmpR n=3 Tax=Erwinia RepID=D2T9B6_ERWP6
Length=463

 Score =  802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/439 (88%), Positives = 414/439 (94%), Gaps = 0/439 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  15   MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  74

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AA+E+GLRWAQHYEFLS QM QQLGGPT
Sbjct  75   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAADESGLRWAQHYEFLSQQMGQQLGGPT  134

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNKSSPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  135  DVRVEVNKSSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  194

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG IPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  195  IQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  254

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM+EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  255  VSHDLRTPLTRIRLATEMMAEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQFERAD  314

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE A+ PG + + ++PL+IKRA+ANMVVNAARYGNGWIKVSS
Sbjct  315  LNSVLGEVVAAESGYEREIENAVLPGELMLDINPLAIKRAIANMVVNAARYGNGWIKVSS  374

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E  RAWFQVEDDGPGI P+Q KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  375  GSELQRAWFQVEDDGPGIEPDQLKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHYGTL  434

Query  421  ELGTSERGGLSIRAWLPVP  439
            E+G S++GGL IRA+LP+P
Sbjct  435  EIGKSDKGGLRIRAYLPLP  453


> UniRef100_U2N160 Osmolarity sensory histidine kinase EnvZ n=1 
Tax=Serratia fonticola AU-AP2C RepID=U2N160_SERFO
Length=456

 Score =  802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/447 (86%), Positives = 415/447 (92%), Gaps = 0/447 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYQFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWL P+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E+ D
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTEICD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN++LGEV+A ESGYER IET + PG + V +HPLSIKRAV NMVVNAARYGNGWIKVSS
Sbjct  301  LNSILGEVVATESGYERVIETDILPGELMVDVHPLSIKRAVVNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  R WFQVEDDGPGI PE+ KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G+L
Sbjct  361  GRELQRGWFQVEDDGPGIKPEELKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGVL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTT  447
            ++GTSERGGL IRA+LP+P+ + + ++
Sbjct  421  DIGTSERGGLRIRAYLPIPIEKKETSS  447


> UniRef100_E0M0P1 Integral membrane sensor signal transduction 
histidine kinase n=2 Tax=Pantoea RepID=E0M0P1_9ENTR
Length=455

 Score =  802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/438 (88%), Positives = 412/438 (94%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+RLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QM QQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYEFLSEQMGQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE A+ P  + + ++PLSIKRA+AN+VVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIENAVMPEELMLDINPLSIKRALANLVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E +RAWFQVEDDGPGI P+Q  HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GRELHRAWFQVEDDGPGIKPDQLAHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHQGSL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G SERGGL IRAWLP+
Sbjct  421  EIGESERGGLRIRAWLPL  438


> UniRef100_H3RHN8 Sensory histidine kinase in two-component regulatory 
system with OmpR n=1 Tax=Pantoea stewartii subsp. stewartii 
DC283 RepID=H3RHN8_PANSE
Length=454

 Score =  802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/441 (88%), Positives = 414/441 (93%), Gaps = 0/441 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QM QQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMGQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM+EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMNEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE A+    + ++++PLSIKRA+AN+VVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIENAVMAEELMLEINPLSIKRALANLVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E +RAWFQVEDDGPGI P+Q  HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GRELHRAWFQVEDDGPGIKPDQLAHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHQGSL  420

Query  421  ELGTSERGGLSIRAWLPVPVT  441
            E+G SERGGL IRAWLP+  T
Sbjct  421  EIGDSERGGLRIRAWLPLAET  441


> UniRef100_UPI000346458A osmolarity sensor protein n=1 Tax=Erwinia 
toletana RepID=UPI000346458A
Length=453

 Score =  801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/439 (87%), Positives = 413/439 (94%), Gaps = 0/439 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRFRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYQFLSEQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG+IPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGVIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS++DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSQEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE  +    + V+++PLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIENEVMATELMVEINPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E  RAWFQVEDDGPGI PEQ KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GSELQRAWFQVEDDGPGIEPEQLKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHQGSL  420

Query  421  ELGTSERGGLSIRAWLPVP  439
            ++G SERGGL IRAWLP+P
Sbjct  421  DIGVSERGGLRIRAWLPLP  439


> UniRef100_D4GD23 EnvZ n=5 Tax=Pantoea ananas RepID=D4GD23_PANAM
Length=454

 Score =  801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/448 (86%), Positives = 415/448 (92%), Gaps = 0/448 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QM QQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMGQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM+EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMNEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTELAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE A+    + ++++PLSIKRA+AN+VVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIENAVMAEELMLEINPLSIKRALANLVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E +RAWFQVEDDGPGI P+Q  HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GRELHRAWFQVEDDGPGIKPDQLAHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHQGSL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTK  448
            E+G SERGGL IRAWLP+  +   G   
Sbjct  421  EIGDSERGGLRIRAWLPLAESPESGANN  448


> UniRef100_UPI00020DA542 osmolarity sensor protein n=1 Tax=Plautia 
stali symbiont RepID=UPI00020DA542
Length=452

 Score =  801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/443 (87%), Positives = 412/443 (93%), Gaps = 0/443 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRML+TD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLITD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VP AFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   RLQLEDGTQLEVPTAFRREIYRELGISLYTNAAAEESGLRWAQHYEFLSEQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE A+    + + ++PLSIKRAVAN+VVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIENAVMDAELMLDINPLSIKRAVANLVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E NRAWFQVEDD PGI P+Q +HL QPFVRGDSAR+ SGTGLGLAIVQRI+D H+G L
Sbjct  361  GQELNRAWFQVEDDSPGIKPDQLQHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHDGSL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRA  443
            E+G S+RGGL IRAWLP+P   A
Sbjct  421  EIGDSKRGGLRIRAWLPIPENSA  443


> UniRef100_U4W6D0 Osmolarity sensor protein n=1 Tax=Pantoea agglomerans 
Tx10 RepID=U4W6D0_ENTAG
Length=455

 Score =  801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/438 (88%), Positives = 412/438 (94%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+RLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QM QQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYEFLSEQMGQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE A+ P  + + ++PLSIKRA+AN+VVNAARYGNGWI+VSS
Sbjct  301  LNSVLGEVVAAESGYEREIENAVMPEELMLDINPLSIKRALANLVVNAARYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E +RAWFQVEDDGPGI P+Q  HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GRELHRAWFQVEDDGPGIKPDQLAHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHQGSL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G SERGGL IRAWLP+
Sbjct  421  EIGESERGGLRIRAWLPL  438


> UniRef100_U2LQP9 Osmolarity sensory histidine kinase EnvZ n=1 
Tax=Serratia fonticola AU-P3(3) RepID=U2LQP9_SERFO
Length=456

 Score =  801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/447 (86%), Positives = 415/447 (92%), Gaps = 0/447 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYQFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWL P+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E+ D
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTEICD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN++LGEV+A ESGYER IET + PG + V +HPLSIKRAV NMVVNAARYGNGWIKVSS
Sbjct  301  LNSILGEVVATESGYERVIETDILPGELMVDVHPLSIKRAVVNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  R WFQVEDDGPGI PE+ KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G+L
Sbjct  361  GRELQRGWFQVEDDGPGIKPEELKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGVL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTT  447
            ++GTSERGGL IRA+LP+P+ + + ++
Sbjct  421  DIGTSERGGLCIRAYLPLPLEKKETSS  447


> UniRef100_D8MY26 Osmolarity sensor protein n=1 Tax=Erwinia billingiae 
(strain Eb661) RepID=D8MY26_ERWBE
Length=450

 Score =  799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/439 (88%), Positives = 412/439 (93%), Gaps = 0/439 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRIRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAA+QVGKGIIPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAAIQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS++DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSQEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQFERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN VLGEV+AAESGYEREIE  +    + V ++PLSIKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNGVLGEVVAAESGYEREIENEVMTSELMVDINPLSIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E  RAWFQVEDDGPGI P+Q KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GSELQRAWFQVEDDGPGIRPDQLKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHQGSL  420

Query  421  ELGTSERGGLSIRAWLPVP  439
            E+G S+RGGL IRA+LP+P
Sbjct  421  EIGDSDRGGLRIRAYLPLP  439


> UniRef100_N1L9I4 Osmolarity sensor protein n=1 Tax=Yersinia enterocolitica 
(type O:2) str. YE3094/96 RepID=N1L9I4_YEREN
Length=450

 Score =  799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/440 (88%), Positives = 412/440 (93%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVK LADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +D
Sbjct  241  VSHDLRTPLTRIRLATEMMSEADGYLSESINKDIEECNAIIEQFIDYLRTGQEMPTEPSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYER IET L  G + V +HPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYERVIETDLCEGEVMVDIHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE  RAWFQVEDDGPGI PE  KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GTELQRAWFQVEDDGPGIKPEDFKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            ++GTSERGGL IRA++P+P+
Sbjct  421  DIGTSERGGLRIRAYIPLPL  440


> UniRef100_A1JSI0 Osmolarity sensor protein n=2 Tax=Yersinia enterocolitica 
subsp. enterocolitica RepID=A1JSI0_YERE8
Length=450

 Score =  798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/440 (88%), Positives = 412/440 (93%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVK LADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +D
Sbjct  241  VSHDLRTPLTRIRLATEMMSEADGYLSESINKDIEECNAIIEQFIDYLRTGQEMPTEPSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYER IET L  G + V +HPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYERVIETDLCEGEVMVDIHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE  RAWFQVEDDGPGI PE  KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GTELQRAWFQVEDDGPGIKPEDLKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            ++GTSERGGL IRA++P+P+
Sbjct  421  DIGTSERGGLRIRAYIPLPL  440


> UniRef100_UPI00026D2812 osmolarity sensor protein n=1 Tax=Enterobacter 
agglomerans RepID=UPI00026D2812
Length=455

 Score =  798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/438 (88%), Positives = 411/438 (93%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+RLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AA E+GLRWAQHYEFLS QM QQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAAAESGLRWAQHYEFLSEQMGQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVG+GIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGRGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE A+ P  + + ++PLSIKRA+AN+VVNAARYGNGWI+VSS
Sbjct  301  LNSVLGEVVAAESGYEREIENAVMPEELMLDINPLSIKRALANLVVNAARYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E +RAWFQVEDDGPGI P+Q  HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GRELHRAWFQVEDDGPGIKPDQLAHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHQGSL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+G SERGGL IRAWLP+
Sbjct  421  EIGESERGGLRIRAWLPL  438


> UniRef100_W0URN1 Osmolarity sensor protein n=1 Tax=Yersinia enterocolitica 
(type O:5) str. YE53/03 RepID=W0URN1_YEREN
Length=450

 Score =  798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/440 (88%), Positives = 412/440 (93%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVK LADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +D
Sbjct  241  VSHDLRTPLTRIRLATEMMSEADGYLSESINKDIEECNAIIEQFIDYLRTGQEMPTEPSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYER IET L  G + V +HPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYERVIETDLCEGEVMVDIHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE  RAWFQVEDDGPGI PE  KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GTELQRAWFQVEDDGPGIKPEDLKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            ++GTSERGGL IRA++P+P+
Sbjct  421  DIGTSERGGLRIRAYIPLPL  440


> UniRef100_F0KVN9 Osmolarity sensor protein n=9 Tax=Yersinia enterocolitica 
RepID=F0KVN9_YERE3
Length=450

 Score =  798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/440 (88%), Positives = 412/440 (93%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVK LADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +D
Sbjct  241  VSHDLRTPLTRIRLATEMMSEADGYLSESINKDIEECNAIIEQFIDYLRTGQEMPTEPSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYER IET L  G + V +HPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYERVIETDLCEGEVMVDIHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE  RAWFQVEDDGPGI PE  KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GTELQRAWFQVEDDGPGIKPEDLKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            ++GTSERGGL IRA++P+P+
Sbjct  421  DIGTSERGGLRIRAYIPLPL  440


> UniRef100_S0ALC9 Osmolarity sensor protein EnvZ n=2 Tax=Serratia 
plymuthica RepID=S0ALC9_SERPL
Length=456

 Score =  798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/444 (86%), Positives = 414/444 (93%), Gaps = 0/444 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYQFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWL P+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E++D
Sbjct  241  VSHDLRTPLTRIRLATEMMSAEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTELSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN++LGEV+AAESGYER IETA+ PG + + +HPLSIKRA  NMVVNAARYGNGWIKVSS
Sbjct  301  LNSILGEVVAAESGYERVIETAIAPGELMMNVHPLSIKRAAVNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  R WFQVEDDGPGI PE+ KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H+G L
Sbjct  361  GRELQRGWFQVEDDGPGIKPEELKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDGHHGAL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQ  444
            ++GTSERGGL IRA++P+P+ + +
Sbjct  421  DIGTSERGGLLIRAYIPLPMEKKE  444


> UniRef100_D4I336 Protein histidine kinase/phosphatase sensor 
for OmpR n=14 Tax=Erwinia amylovora RepID=D4I336_ERWAC
Length=449

 Score =  798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/439 (87%), Positives = 412/439 (93%), Gaps = 0/439 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AA+E+GLRWAQHYEFLS QM QQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAADESGLRWAQHYEFLSQQMGQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG IPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM+EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMAEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQFERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN VLGEV+AAESGYEREIE A+ PG + + ++PL+IKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNGVLGEVVAAESGYEREIENAVLPGELLLDINPLAIKRAIANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E  R WFQVEDDGPGI P+Q +HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GSELQRVWFQVEDDGPGIEPDQLQHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHYGTL  420

Query  421  ELGTSERGGLSIRAWLPVP  439
            E+G SE+GGL IRA+LP+P
Sbjct  421  EIGKSEKGGLRIRAYLPLP  439


> UniRef100_G0BAF7 Integral membrane sensor signal transduction 
histidine kinase n=3 Tax=Serratia RepID=G0BAF7_SERSA
Length=456

 Score =  798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/444 (86%), Positives = 414/444 (93%), Gaps = 0/444 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYQFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWL P+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E++D
Sbjct  241  VSHDLRTPLTRIRLATEMMSTEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTELSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN++LGEV+AAESGYER IETA+ PG + + +HPLSIKRA  NMVVNAARYGNGWIKVSS
Sbjct  301  LNSILGEVVAAESGYERVIETAIAPGELMMNVHPLSIKRAAVNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  R WFQVEDDGPGI PE+ KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H+G L
Sbjct  361  GRELQRGWFQVEDDGPGIKPEELKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDGHHGAL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQ  444
            ++GTSERGGL IRA++P+P+ + +
Sbjct  421  DIGTSERGGLLIRAYIPLPMEKKE  444


> UniRef100_W8TXW9 Osmolarity sensor protein EnvZ n=2 Tax=Yersinia 
enterocolitica RepID=W8TXW9_YEREN
Length=453

 Score =  796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/440 (88%), Positives = 411/440 (93%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVK LADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +D
Sbjct  241  VSHDLRTPLTRIRLATEMMSEADGYLSESINKDIEECNAIIEQFIDYLRTGQEMPTEPSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYER IET L  G + V +HPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYERVIETDLCAGEVMVDIHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE  RAWFQVEDDGPGI PE  KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GTELQRAWFQVEDDGPGIKPEDLKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            ++GTS RGGL IRA++P+P+
Sbjct  421  DIGTSARGGLRIRAYIPLPL  440


> UniRef100_B2VJV0 Osmolarity sensor protein n=1 Tax=Erwinia tasmaniensis 
(strain DSM 17950 / Et1/99) RepID=B2VJV0_ERWT9
Length=449

 Score =  796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/439 (87%), Positives = 413/439 (94%), Gaps = 0/439 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AA+E+GLRWAQHYEFLS QM QQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAADESGLRWAQHYEFLSQQMGQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG IPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM+EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMAEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQFERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE A+ PG + V ++PL+IKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIENAVLPGELMVDINPLAIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVED+GPGI P+Q +HL QPFVRGDSAR+ SGTGLGLAIVQRIVD H+G L
Sbjct  361  GRELQRAWFQVEDNGPGIEPDQLQHLLQPFVRGDSARSTSGTGLGLAIVQRIVDAHHGAL  420

Query  421  ELGTSERGGLSIRAWLPVP  439
            E+ +SE+GGL IRA+LP+P
Sbjct  421  EIDSSEQGGLRIRAYLPLP  439


> UniRef100_E7B847 Osmolarity sensory histidine kinase EnvZ n=4 
Tax=Yersinia enterocolitica subsp. palearctica RepID=E7B847_YERE1
Length=450

 Score =  796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/440 (88%), Positives = 411/440 (93%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEI QGDFSPLFRYTLAIMLLA+GGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIQQGDFSPLFRYTLAIMLLAVGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVK LADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +D
Sbjct  241  VSHDLRTPLTRIRLATEMMSEADGYLSESINKDIEECNAIIEQFIDYLRTGQEMPTEPSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYER IET L  G + V +HPLSIKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNAVLGEVIAAESGYERVIETDLCEGEVMVDIHPLSIKRALANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE  RAWFQVEDDGPGI PE  KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GTELQRAWFQVEDDGPGIKPEDLKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            ++GTSERGGL IRA++P+P+
Sbjct  421  DIGTSERGGLRIRAYIPLPL  440


> UniRef100_E8XV17 Integral membrane sensor signal transduction 
histidine kinase n=2 Tax=Rahnella RepID=E8XV17_RAHSY
Length=453

 Score =  795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/440 (87%), Positives = 409/440 (92%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRIRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLAVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVK LADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS+ D YLAESINKDIEECNAIIEQFIDYLRTGQEMP E+ D
Sbjct  241  VSHDLRTPLTRIRLATEMMSDDDSYLAESINKDIEECNAIIEQFIDYLRTGQEMPTEITD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN +LGEVIA ESGYEREI++ L  G + V  HPLSIKRAV NMVVNAARYG+GWIKVSS
Sbjct  301  LNGILGEVIATESGYEREIDSGLADGELLVNAHPLSIKRAVVNMVVNAARYGDGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI P+Q KHLFQPFVRG+SART SGTGLGLAIVQRI+D H+G L
Sbjct  361  GRELQRAWFQVEDDGPGIEPDQLKHLFQPFVRGESARTTSGTGLGLAIVQRIIDAHSGTL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            ++G S+RGGL IRA+LP+PV
Sbjct  421  DIGKSDRGGLRIRAYLPLPV  440


> UniRef100_UPI0002EFDD2E osmolarity sensor protein n=1 Tax=Serratia 
marcescens RepID=UPI0002EFDD2E
Length=453

 Score =  795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/441 (86%), Positives = 411/441 (93%), Gaps = 0/441 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD+LQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VR
Sbjct  61   LEDGTLLEVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYQFLSQQMAQQLGGPTDVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNK+SPVVWLKTWL P+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKNSPVVWLKTWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAGVSH
Sbjct  181  RPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEMP E +DLNA
Sbjct  241  DLRTPLTRIRLATEMMSAEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPTESSDLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            +LGEV+AAESGYER IETAL PG + + +HPLSIKRA  NMVVNAARYGNGWIKVSSG E
Sbjct  301  ILGEVVAAESGYERVIETALSPGELMMNVHPLSIKRAAVNMVVNAARYGNGWIKVSSGRE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
              R WFQVEDDGPGI PE+ KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H+G L++G
Sbjct  361  LQRGWFQVEDDGPGIKPEELKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHDGALDIG  420

Query  424  TSERGGLSIRAWLPVPVTRAQ  444
            TSERGGL IRA++P+P+ + +
Sbjct  421  TSERGGLLIRAYIPLPMEKKE  441


> UniRef100_V6D3I5 Protein histidine kinase/phosphatase sensor 
for OmpR n=1 Tax=Erwinia amylovora LA636 RepID=V6D3I5_ERWAM
Length=449

 Score =  795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/439 (87%), Positives = 411/439 (93%), Gaps = 0/439 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AA+E+GL WAQHYEFLS QM QQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAADESGLCWAQHYEFLSQQMGQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG IPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM+EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMAEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQFERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN VLGEV+AAESGYEREIE A+ PG + + ++PL+IKRA+ANMVVNAARYGNGWIKVSS
Sbjct  301  LNGVLGEVVAAESGYEREIENAVLPGELLLDINPLAIKRAIANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E  R WFQVEDDGPGI P+Q +HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GSELQRVWFQVEDDGPGIEPDQLQHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHYGTL  420

Query  421  ELGTSERGGLSIRAWLPVP  439
            E+G SE+GGL IRA+LP+P
Sbjct  421  EIGKSEKGGLRIRAYLPLP  439


> UniRef100_M3BKI4 Osmolarity sensor protein n=2 Tax=Serratia marcescens 
RepID=M3BKI4_SERMA
Length=453

 Score =  795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/444 (86%), Positives = 412/444 (92%), Gaps = 0/444 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD+LQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VR
Sbjct  61   LEDGTLLEVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYQFLSQQMAQQLGGPTDVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNK+SPVVWLKTWL P+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKNSPVVWLKTWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAGVSH
Sbjct  181  RPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEMP E +DLNA
Sbjct  241  DLRTPLTRIRLATEMMSAEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPTESSDLNA  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            +LGEV+AAESGYER IETAL PG + + +HPLSIKRA  NMVVNAARYGNGWIKVSSG E
Sbjct  301  ILGEVVAAESGYERVIETALSPGELMMNVHPLSIKRAAVNMVVNAARYGNGWIKVSSGRE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
              R WFQVEDDGPGI P++ KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H+G L++G
Sbjct  361  LQRGWFQVEDDGPGIKPDELKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHDGELDIG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTT  447
            TSERGGL IRA++P+P+ + + T 
Sbjct  421  TSERGGLLIRAYIPLPMEKKESTN  444


> UniRef100_H2IQG1 Signal transduction histidine kinase n=1 Tax=Rahnella 
aquatilis (strain ATCC 33071 / DSM 4594 / JCM 1683 
/ NBRC 105701 / NCIMB 13365 / CIP 78.65) RepID=H2IQG1_RAHAC
Length=453

 Score =  795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/440 (87%), Positives = 409/440 (92%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+R+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKRIRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLAVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVK LADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM + D YLAESINKDIEECNAIIEQFIDYLRTGQEMP E+ D
Sbjct  241  VSHDLRTPLTRIRLATEMMGDDDSYLAESINKDIEECNAIIEQFIDYLRTGQEMPTEITD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN +LGEVIA ESGYEREI++ L  G + V  HPLSIKRAV NMVVNAARYG+GWIKVSS
Sbjct  301  LNGILGEVIATESGYEREIDSDLADGELLVNAHPLSIKRAVVNMVVNAARYGDGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGIAP+Q KHLFQPFVRG+SART SGTGLGLAIVQRI+D H+G L
Sbjct  361  GRELQRAWFQVEDDGPGIAPDQLKHLFQPFVRGESARTTSGTGLGLAIVQRIIDAHSGTL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            ++G S+RGGL IRA+LP+PV
Sbjct  421  DIGKSDRGGLRIRAYLPLPV  440


> UniRef100_U3U262 Integral membrane sensor signal transduction 
histidine kinase n=1 Tax=Plautia stali symbiont RepID=U3U262_9ENTR
Length=449

 Score =  795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/440 (87%), Positives = 409/440 (92%), Gaps = 0/440 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRML+TD+LQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLITDRLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGTQL VP AFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMAQQLGGPT+VR
Sbjct  61   LEDGTQLEVPTAFRREIYRELGISLYTNAAAEESGLRWAQHYEFLSEQMAQQLGGPTDVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAGVSH
Sbjct  181  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMM E+DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E ADLN+
Sbjct  241  DLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTERADLNS  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            VLGEV+AAESGYEREIE A+    + + ++PLSIKRAVAN+VVNAARYGNGWIKVSSG E
Sbjct  301  VLGEVVAAESGYEREIENAVMDAELMLDINPLSIKRAVANLVVNAARYGNGWIKVSSGQE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
             NRAWFQVEDD PGI P+Q +HL QPFVRGDSAR+ SGTGLGLAIVQRI+D H+G LE+G
Sbjct  361  LNRAWFQVEDDSPGIKPDQLQHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHDGSLEIG  420

Query  424  TSERGGLSIRAWLPVPVTRA  443
             S+RGGL IRAWLP+P   A
Sbjct  421  DSKRGGLRIRAWLPIPENSA  440


> UniRef100_V5ZC79 Protein histidine kinase/phosphatase sensor 
for OmpR n=1 Tax=Erwinia piriflorinigrans CFBP 5888 RepID=V5ZC79_9ENTR
Length=449

 Score =  794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/439 (87%), Positives = 414/439 (94%), Gaps = 0/439 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AA+E+GLRWAQHYEFLS QM QQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAADESGLRWAQHYEFLSQQMGQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG IPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM+EQDGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMAEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQFERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE A+ PG + + ++PL+IKRAVANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIENAVLPGELMLDINPLAIKRAVANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E  RAWFQVED+GPGI P+Q +HL QPFVRGDSAR+ SGTGLGLAIVQRI+D H+G L
Sbjct  361  GSELQRAWFQVEDNGPGIEPDQLQHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHHGAL  420

Query  421  ELGTSERGGLSIRAWLPVP  439
            E+ +SE+GGL IRA+LP+P
Sbjct  421  EIDSSEQGGLRIRAYLPLP  439


> UniRef100_W0LCJ4 Osmolarity sensor protein n=1 Tax=Serratia fonticola 
RB-25 RepID=W0LCJ4_SERFO
Length=456

 Score =  792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/444 (85%), Positives = 412/444 (92%), Gaps = 0/444 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MR LRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRLLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYQFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWL P+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG+IPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGMIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E++D
Sbjct  241  VSHDLRTPLTRIRLATEMMSTEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTELSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+LGEV+AAESGYER IET++ P  + + +HPLSIKRA  NMVVNAARYGNGWIKVSS
Sbjct  301  LNAILGEVVAAESGYERVIETSILPDELMMNVHPLSIKRAAVNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  R WFQVEDDGPGI PE+ KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H G+L
Sbjct  361  GRELQRGWFQVEDDGPGIKPEELKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGVL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQ  444
            ++GTSERGGL IRA++P+P+ + +
Sbjct  421  DIGTSERGGLRIRAYIPLPMEKKE  444


> UniRef100_UPI000360DED8 osmolarity sensor protein n=1 Tax=gamma 
proteobacterium WG36 RepID=UPI000360DED8
Length=451

 Score =  792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/437 (87%), Positives = 406/437 (92%), Gaps = 0/437 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MR++RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRKIRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTLLEVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKDIEE NAIIEQFIDYLRTGQEM  E+ D
Sbjct  241  VSHDLRTPLTRIRLATEMMSSEDGYLAESINKDIEESNAIIEQFIDYLRTGQEMQTEVCD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN++LGEV+AAESGYEREIET L  G + V +HPLSIKRA  NMVVNAARYGNGWIKVSS
Sbjct  301  LNSILGEVVAAESGYEREIETDLVDGDVLVNVHPLSIKRAAVNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E NR+WFQVEDDGPGI P+Q  HLFQPFVRGDSARTISGTGLGLAIVQRI+D H G L
Sbjct  361  GHELNRSWFQVEDDGPGIEPDQLAHLFQPFVRGDSARTISGTGLGLAIVQRIIDAHAGSL  420

Query  421  ELGTSERGGLSIRAWLP  437
            ++G S RGGL  RA+LP
Sbjct  421  DIGKSPRGGLRFRAYLP  437


> UniRef100_L0VTP0 Osmolarity sensor protein EnvZ n=1 Tax=Serratia 
plymuthica A30 RepID=L0VTP0_SERPL
Length=453

 Score =  791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/441 (85%), Positives = 411/441 (93%), Gaps = 0/441 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD+LQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VR
Sbjct  61   LEDGTLLEVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYQFLSQQMAQQLGGPTDVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNK+SPVVWLKTWL P+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKNSPVVWLKTWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAGVSH
Sbjct  181  RPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E++DLN+
Sbjct  241  DLRTPLTRIRLATEMMSAEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTELSDLNS  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            +LGEV+AAESGYER IETA+ PG + + +HPLSIKRA  NMVVNAARYGNGWIKVSSG E
Sbjct  301  ILGEVVAAESGYERVIETAIAPGELMMNVHPLSIKRAAVNMVVNAARYGNGWIKVSSGRE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
              R WFQVEDDGPGI PE+ KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H+G L++G
Sbjct  361  LQRGWFQVEDDGPGIKPEELKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDGHHGALDIG  420

Query  424  TSERGGLSIRAWLPVPVTRAQ  444
            TSERGGL IRA++P+P+ + +
Sbjct  421  TSERGGLLIRAYIPLPMEKKE  441


> UniRef100_I3ALC0 Osmolarity sensor protein n=1 Tax=Serratia plymuthica 
PRI-2C RepID=I3ALC0_SERPL
Length=453

 Score =  791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/444 (85%), Positives = 412/444 (92%), Gaps = 0/444 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD+LQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VR
Sbjct  61   LEDGTLLEVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYQFLSQQMAQQLGGPTDVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNK+SPVVWLKTWL P+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKNSPVVWLKTWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAGVSH
Sbjct  181  RPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E++DLN+
Sbjct  241  DLRTPLTRIRLATEMMSTEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTELSDLNS  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            +LGEV+AAESGYER IETA+ PG + + +HPLSIKRA  NMVVNAARYGNGWIKVSSG E
Sbjct  301  ILGEVVAAESGYERVIETAMAPGELMMNVHPLSIKRAAVNMVVNAARYGNGWIKVSSGRE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
              R WFQVEDDGPGI PE+ KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H+G L++G
Sbjct  361  LQRGWFQVEDDGPGIKPEELKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDGHHGALDIG  420

Query  424  TSERGGLSIRAWLPVPVTRAQGTT  447
            TSERGGL IRA++P+P+ + + T 
Sbjct  421  TSERGGLLIRAYIPLPMEKKEPTN  444


> UniRef100_A0A014NAW6 Osmolarity sensor protein n=1 Tax=Erwinia 
mallotivora RepID=A0A014NAW6_9ENTR
Length=450

 Score =  789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/450 (87%), Positives = 415/450 (92%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRIRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   RLQLEDGTQLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS++DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSQEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN VLGEV+AAESGYEREIE A+ P  + + ++PLSIKRA ANMVVNAARYGNGWIKVSS
Sbjct  301  LNGVLGEVVAAESGYEREIENAVMPAELMLDINPLSIKRAAANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E  RAWFQVEDDGPGIAP+Q KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GSELERAWFQVEDDGPGIAPDQLKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHQGTL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E+G SERGGL IRA+LP+P          G
Sbjct  421  EVGESERGGLRIRAYLPLPAAEVSALATSG  450


> UniRef100_L0MP79 Signal transduction histidine kinase n=1 Tax=Serratia 
marcescens FGI94 RepID=L0MP79_SERMA
Length=457

 Score =  788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/450 (84%), Positives = 409/450 (90%), Gaps = 0/450 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMA+QLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYEFLSQQMARQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG IPPPLREYGASEVRSVTRAFN M +GVKQL+DDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQMTSGVKQLSDDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM  +DGYLAESINKDIEECN IIEQFIDYLRTGQEM  E+ D
Sbjct  241  VSHDLRTPLTRIRLATEMMGAEDGYLAESINKDIEECNDIIEQFIDYLRTGQEMQTELCD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+LGEVIAAESGYEREI+ +L PG + + +HPLSIKRAV NMVVNAARYGNGWIKVSS
Sbjct  301  LNAILGEVIAAESGYEREIDASLAPGELLMNVHPLSIKRAVVNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G+E  R WFQVEDDGPGI PE+ KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GSELQRGWFQVEDDGPGIKPEELKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDGHAGAL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTTKEG  450
            E G SERGGL +RA++P+P+     +   G
Sbjct  421  EFGVSERGGLRMRAYIPLPIATRDASNGNG  450


> UniRef100_S5EQN5 Osmolarity sensor protein n=1 Tax=Serratia liquefaciens 
ATCC 27592 RepID=S5EQN5_SERLI
Length=453

 Score =  788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/441 (85%), Positives = 410/441 (92%), Gaps = 0/441 (0%)

Query  4    LRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ  63
            +RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD+LQ
Sbjct  1    MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQ  60

Query  64   LEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR  123
            LEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VR
Sbjct  61   LEDGTLLEVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYQFLSQQMAQQLGGPTDVR  120

Query  124  VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  183
            VEVNK+SPVVWLKTWL P+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
Sbjct  121  VEVNKNSPVVWLKTWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN  180

Query  184  RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH  243
            RPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAGVSH
Sbjct  181  RPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAGVSH  240

Query  244  DLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNA  303
            DLRTPLTRIRLATEMMS +DGYLAESINKDIEECN IIEQFIDYLRTGQEM  E++DLN+
Sbjct  241  DLRTPLTRIRLATEMMSAEDGYLAESINKDIEECNDIIEQFIDYLRTGQEMQTEISDLNS  300

Query  304  VLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE  363
            +LGEV+AAESGYER IETAL PG + + +HPLSIKRA  NMVVNAARYGNGWIKVSSG E
Sbjct  301  ILGEVVAAESGYERVIETALAPGELMMNVHPLSIKRAAVNMVVNAARYGNGWIKVSSGRE  360

Query  364  PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELG  423
              R WFQVEDDGPGI PE+ KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H+G L++G
Sbjct  361  LQRGWFQVEDDGPGIKPEELKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDGHHGALDIG  420

Query  424  TSERGGLSIRAWLPVPVTRAQ  444
            TSERGGL IRA++P+P+ + +
Sbjct  421  TSERGGLLIRAYIPLPMEKKE  441


> UniRef100_UPI000329B1B4 PREDICTED: osmolarity sensor protein 
EnvZ-like n=1 Tax=Ceratitis capitata RepID=UPI000329B1B4
Length=411

 Score =  787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/410 (92%), Positives = 393/410 (95%), Gaps = 0/410 (0%)

Query  40   LPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGL  99
            +PSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLYS+EAAE+AGL
Sbjct  1    MPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLYSDEAAEDAGL  60

Query  100  RWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSP  159
            RWAQHYEFLS QMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSP
Sbjct  61   RWAQHYEFLSQQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSP  120

Query  160  LFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRA  219
            LFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRA
Sbjct  121  LFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRA  180

Query  220  FNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNA  279
            FNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMM EQDGYLAESINKDIEECNA
Sbjct  181  FNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNA  240

Query  280  IIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKR  339
            IIEQFIDYLRTGQEMPME ADLNAVLGEV+AAESGYEREIET L PG I V+MHPLSIKR
Sbjct  241  IIEQFIDYLRTGQEMPMEDADLNAVLGEVVAAESGYEREIETNLQPGEIPVRMHPLSIKR  300

Query  340  AVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTI  399
            AVANMVVNAARYGNGWI+VSSG+E NR WFQVEDDGPGI PEQR++LFQPFVRGDSAR+ 
Sbjct  301  AVANMVVNAARYGNGWIRVSSGSEQNRVWFQVEDDGPGIQPEQRQYLFQPFVRGDSARST  360

Query  400  SGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKE  449
            SGTGLGLAIVQRIVDNHNGMLE+GTSERGGL IRAWLPVPV R   + KE
Sbjct  361  SGTGLGLAIVQRIVDNHNGMLEIGTSERGGLLIRAWLPVPVMRVVSSLKE  410


> UniRef100_I0QWY2 Osmolarity sensor protein n=1 Tax=Serratia sp. 
M24T3 RepID=I0QWY2_9ENTR
Length=451

 Score =  786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/437 (87%), Positives = 405/437 (92%), Gaps = 0/437 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MR++RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRKIRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   KLQLEDGTLLEVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +D YLAESINKDIEE NAIIEQFIDYLRTGQEM  E+ D
Sbjct  241  VSHDLRTPLTRIRLATEMMSIEDAYLAESINKDIEESNAIIEQFIDYLRTGQEMQTEVCD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN++LGEV+AAESGYEREIET L  G + V +HPLSIKRA  NMVVNAARYGNGWIKVSS
Sbjct  301  LNSILGEVVAAESGYEREIETDLVDGEVLVNVHPLSIKRAAVNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E NR+WFQVEDDGPGI P+Q  HLFQPFVRGDSARTISGTGLGLAIVQRI+D H G L
Sbjct  361  GHELNRSWFQVEDDGPGIEPDQLAHLFQPFVRGDSARTISGTGLGLAIVQRIIDAHAGSL  420

Query  421  ELGTSERGGLSIRAWLP  437
            ++G S RGGL  RA+LP
Sbjct  421  DIGKSPRGGLRFRAYLP  437


> UniRef100_D4DYP0 ATPase/histidine kinase/DNA gyrase B/HSP90 domain 
protein n=1 Tax=Serratia odorifera DSM 4582 RepID=D4DYP0_SEROD
Length=456

 Score =  786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/447 (84%), Positives = 408/447 (91%), Gaps = 0/447 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG IPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E  D
Sbjct  241  VSHDLRTPLTRIRLATEMMSAEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTEFCD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN++LGEV+AAESGYER I++ L  G + + ++PLSIKRA  NMV+NAARYGNGWIKVSS
Sbjct  301  LNSILGEVVAAESGYERVIDSELLAGELMMNVNPLSIKRAAVNMVINAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  R WFQVEDDGPGI PE+ KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GRELQRGWFQVEDDGPGIKPEELKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDGHAGAL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTT  447
            E G+SERGGL IRA++P+P+ + +   
Sbjct  421  EFGSSERGGLRIRAYIPLPIEKREAAN  447


> UniRef100_E5YM27 Osmolarity sensor protein envZ n=1 Tax=Enterobacteriaceae 
bacterium 9_2_54FAA RepID=E5YM27_9ENTR
Length=462

 Score =  786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/439 (86%), Positives = 404/439 (92%), Gaps = 0/439 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQL VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLEVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYQFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVE++K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEISKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAA+QVGKG IPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAAIQVGKGHIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKD EECNAIIEQFIDYLRTGQEM  E+ D
Sbjct  241  VSHDLRTPLTRIRLATEMMSSEDGYLAESINKDTEECNAIIEQFIDYLRTGQEMQTEVCD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN +L EV+AAESGYER I+T    G + V  HPLSIKRAV NMVVNA RYGNGWIKVSS
Sbjct  301  LNGILAEVVAAESGYERVIDTDFAEGELLVDAHPLSIKRAVVNMVVNATRYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE  +AWFQVEDDGPGIAPEQ  HLFQPFVRG+SART SGTGLGLAI+QRI+D H+G L
Sbjct  361  GTEGKKAWFQVEDDGPGIAPEQLAHLFQPFVRGESARTTSGTGLGLAILQRIIDGHSGSL  420

Query  421  ELGTSERGGLSIRAWLPVP  439
            ++GTSERGGL IRA L  P
Sbjct  421  DIGTSERGGLRIRALLLTP  439


> UniRef100_G9Y419 Osmolarity sensor protein EnvZ n=1 Tax=Hafnia 
alvei ATCC 51873 RepID=G9Y419_HAFAL
Length=462

 Score =  785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/439 (86%), Positives = 404/439 (92%), Gaps = 0/439 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQL VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLEVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYQFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVE++K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEISKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAA+QVGKG IPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAAIQVGKGHIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKD EECNAIIEQFIDYLRTGQEM  E+ D
Sbjct  241  VSHDLRTPLTRIRLATEMMSSEDGYLAESINKDTEECNAIIEQFIDYLRTGQEMQTEVCD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN +L EV+AAESGYER I+T    G + V  HPLSIKRAV NMVVNA RYGNGWIKVSS
Sbjct  301  LNGILAEVVAAESGYERVIDTDFAEGELLVDAHPLSIKRAVVNMVVNATRYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE  +AWFQVEDDGPGIAPEQ  HLFQPFVRG+SART SGTGLGLAI+QRI+D H+G L
Sbjct  361  GTEGKKAWFQVEDDGPGIAPEQLAHLFQPFVRGESARTTSGTGLGLAILQRIIDGHSGSL  420

Query  421  ELGTSERGGLSIRAWLPVP  439
            ++GTSERGGL IRA L  P
Sbjct  421  DIGTSERGGLRIRALLLTP  439


> UniRef100_W8G649 Osmolarity sensor protein n=1 Tax=Yersinia similis 
RepID=W8G649_9ENTR
Length=450

 Score =  784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/440 (86%), Positives = 407/440 (92%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+  RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKWWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG IPPPLREYGASEVRSVTRAFN MAAGVK L+DDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQMAAGVKLLSDDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +D
Sbjct  241  VSHDLRTPLTRIRLATEMMSEDDGYLSESINKDIEECNAIIEQFIDYLRTGQEMPTESSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYER IET L  G + V +HPLSIKRA+ NMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYERVIETDLAEGEVLVDIHPLSIKRALTNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI PE  KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GKELQRAWFQVEDDGPGIKPEDLKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            E+GTS+RGGL IRA++P+P+
Sbjct  421  EIGTSKRGGLRIRAYIPLPL  440


> UniRef100_A7FNU9 Osmolarity sensor protein EnvZ n=1 Tax=Yersinia 
pseudotuberculosis serotype O:1b (strain IP 31758) RepID=A7FNU9_YERP3
Length=450

 Score =  783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/440 (86%), Positives = 407/440 (92%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+  RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKWWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG IPPPLREYGASEVRSVTRAFN MAAGVK L+DDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQMAAGVKLLSDDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +D
Sbjct  241  VSHDLRTPLTRIRLATEMMSEDDGYLSESINKDIEECNAIIEQFIDYLRTGQEMPTESSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYER IET L  G + V +HPLSIKRA+ NMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYERVIETDLAEGEVLVDIHPLSIKRALTNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI PE  KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GKELQRAWFQVEDDGPGIKPEDLKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            E+GTS+RGGL IRA++P+P+
Sbjct  421  EIGTSKRGGLRIRAYIPLPL  440


> UniRef100_A4TGS7 Osmolarity sensor protein n=91 Tax=Yersinia 
RepID=A4TGS7_YERPP
Length=450

 Score =  781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/440 (86%), Positives = 406/440 (92%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+  RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKWWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG IPPPLREYGASEVRSVTRAFN MAAGVK L+DDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQMAAGVKLLSDDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE D YL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +D
Sbjct  241  VSHDLRTPLTRIRLATEMMSEDDAYLSESINKDIEECNAIIEQFIDYLRTGQEMPTEPSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYER IET L  G + V +HPLSIKRA+ NMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYERVIETDLAEGEVLVDIHPLSIKRALTNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI PE  KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GKELQRAWFQVEDDGPGIKPEDLKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            E+GTS+RGGL IRA++P+P+
Sbjct  421  EIGTSKRGGLRIRAYIPLPL  440


> UniRef100_A8GKS3 Integral membrane sensor signal transduction 
histidine kinase n=1 Tax=Serratia proteamaculans (strain 568) 
RepID=A8GKS3_SERP5
Length=459

 Score =  780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/444 (86%), Positives = 414/444 (93%), Gaps = 0/444 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGTLLEVPPAFRREIYRELGISLYTNSAAEESGLRWAQHYQFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWL P+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E++D
Sbjct  241  VSHDLRTPLTRIRLATEMMSAEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTELSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN +LGEV+AAESGYER IETA+ PG + + +HPLSIKRA ANMVVNAARYGNGWIKVSS
Sbjct  301  LNGILGEVVAAESGYERVIETAMAPGELMMNVHPLSIKRAAANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  R WFQVEDDGPGI PE+ KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H+G L
Sbjct  361  GRELQRGWFQVEDDGPGIKPEELKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDGHHGAL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQ  444
            ++GTSERGGL IRA++P+P+ + +
Sbjct  421  DIGTSERGGLLIRAYIPLPMEKKE  444


> UniRef100_V5CBE4 Osmolarity sensor protein EnvZ n=1 Tax=Serratia 
sp. DD3 RepID=V5CBE4_9ENTR
Length=456

 Score =  780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/446 (84%), Positives = 405/446 (90%), Gaps = 0/446 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRL FSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLPFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY++ AA+E+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTDAAAQESGLRWAQHYQFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWL P+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E+ D
Sbjct  241  VSHDLRTPLTRIRLATEMMSVEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTEVCD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN +LGEV+A ESGYER IET + P  + V +HPLSIKRAV NMVVNA RYGNGWI+VSS
Sbjct  301  LNCILGEVVAVESGYERIIETDILPDELRVNVHPLSIKRAVVNMVVNATRYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  R WFQVEDDGPGI PE+  HL QPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GRELQRGWFQVEDDGPGIKPEELPHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGEL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGT  446
            E+G SERGGL IRA++P+ + + + T
Sbjct  421  EIGASERGGLCIRAYIPLLIDKKEAT  446


> UniRef100_Q74Y38 Osmolarity sensor protein n=1 Tax=Yersinia pestis 
RepID=Q74Y38_YERPE
Length=450

 Score =  780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/440 (86%), Positives = 406/440 (92%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+  RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKWWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG IPPPLREYGASEVRSVTRAFN MAAGVK L+DDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQMAAGVKLLSDDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS+ D YL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +D
Sbjct  241  VSHDLRTPLTRIRLATEMMSDDDAYLSESINKDIEECNAIIEQFIDYLRTGQEMPTEPSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYER IET L  G + V +HPLSIKRA+ NMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYERVIETDLAEGEVLVDIHPLSIKRALTNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI PE  KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GKELQRAWFQVEDDGPGIKPEDLKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            E+GTS+RGGL IRA++P+P+
Sbjct  421  EIGTSKRGGLRIRAYIPLPL  440


> UniRef100_V9GRD1 Putative two-component histidine kinase (Fragment) 
n=2 Tax=Yersinia RepID=V9GRD1_YERPU
Length=453

 Score =  779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/440 (86%), Positives = 406/440 (92%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+  RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MKWWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG IPPPLREYGASEVRSVTRAFN MAAGVK L+DDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQMAAGVKLLSDDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE D YL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +D
Sbjct  241  VSHDLRTPLTRIRLATEMMSEDDAYLSESINKDIEECNAIIEQFIDYLRTGQEMPTEPSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEVIAAESGYER IET L  G + V +HPLSIKRA+ NMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVIAAESGYERVIETDLAEGEVLVDIHPLSIKRALTNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI PE  KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GKELQRAWFQVEDDGPGIKPEDLKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            E+GTS+RGGL IRA++P+P+
Sbjct  421  EIGTSKRGGLRIRAYIPLPL  440


> UniRef100_UPI000366BE7C osmolarity sensor protein n=1 Tax=Dickeya 
zeae RepID=UPI000366BE7C
Length=470

 Score =  779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/446 (84%), Positives = 410/446 (91%), Gaps = 0/446 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R RFSPRS+FARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MIRWRFSPRSAFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDG+ L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGSTLDVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR
Sbjct  121  EVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            +QNRPLV+LEHAA+QVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  VQNRPLVELEHAAIQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM ++D YLAESINKDIEECNAIIEQFIDYLRTGQEM ME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGQEDEYLAESINKDIEECNAIIEQFIDYLRTGQEMQMEVAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+LGEV+A+ESGYEREI++ L  G + +K+ PLSIKRAVAN+VVNAARYGNGWI+VSS
Sbjct  301  LNAILGEVVASESGYEREIDSELTLGELPMKVSPLSIKRAVANLVVNAARYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI P Q  HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D HNG L
Sbjct  361  GRELQRAWFQVEDDGPGIDPSQLAHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHNGSL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGT  446
            ++G SERGGL +RA+LP+    + GT
Sbjct  421  DVGKSERGGLRVRAYLPLAFPNSSGT  446


> UniRef100_UPI0002E5D800 osmolarity sensor protein n=1 Tax=Dickeya 
zeae RepID=UPI0002E5D800
Length=470

 Score =  777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/446 (84%), Positives = 410/446 (91%), Gaps = 0/446 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R RFSPRS+FARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MIRWRFSPRSAFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDG+ L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGSTLDVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR
Sbjct  121  EVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            +QNRPLV+LEHAA+QVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  VQNRPLVELEHAAIQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM ++D YLAESINKDIEECNAIIEQFIDYLRTGQEM ME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGQEDEYLAESINKDIEECNAIIEQFIDYLRTGQEMQMEVAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+LGEV+A+ESGYEREI++ L  G + +K+ PLSIKRAVAN+VVNAARYGNGWI+VSS
Sbjct  301  LNAILGEVVASESGYEREIDSELTLGELPMKVSPLSIKRAVANLVVNAARYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI P Q  HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D HNG L
Sbjct  361  GRELQRAWFQVEDDGPGIDPSQLAHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHNGSL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGT  446
            ++G+SERGGL +RA+LP+      GT
Sbjct  421  DVGSSERGGLRVRAYLPLAFPNPSGT  446


> UniRef100_D2BY53 Integral membrane sensor signal transduction 
histidine kinase n=1 Tax=Dickeya dadantii (strain Ech586) RepID=D2BY53_DICD5
Length=470

 Score =  777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/446 (84%), Positives = 409/446 (91%), Gaps = 0/446 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R RFSPRS+FARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MIRWRFSPRSAFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDG+ L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGSTLDVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR
Sbjct  121  EVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            +QNRPLV+LEHAA+QVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  VQNRPLVELEHAAIQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM ++D YLAESINKDIEECNAIIEQFIDYLRTGQEM ME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGQEDEYLAESINKDIEECNAIIEQFIDYLRTGQEMQMEVAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+LGEV+A+ESGYEREI++ L  G + +K+ PLSIKRAVAN+VVNAARYGNGWI+VSS
Sbjct  301  LNAILGEVVASESGYEREIDSELTLGELPMKVSPLSIKRAVANLVVNAARYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI P Q  HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D HNG L
Sbjct  361  GRELQRAWFQVEDDGPGIDPSQLAHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHNGSL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGT  446
            ++G SERGGL +RA+LP+      GT
Sbjct  421  DVGKSERGGLRVRAYLPLAFPNPSGT  446


> UniRef100_E0SJT2 Sensory histidine kinase in two-component regulatory 
system with OmpR n=1 Tax=Dickeya dadantii (strain 3937) 
RepID=E0SJT2_DICD3
Length=467

 Score =  777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/447 (84%), Positives = 409/447 (91%), Gaps = 0/447 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R RFSPRS+FARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MIRWRFSPRSAFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDG+ L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGSTLDVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR
Sbjct  121  EVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            +QNRPLV+LEHAA+QVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  VQNRPLVELEHAAIQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM ++D YLAESINKDIEECNAIIEQFIDYLRTGQEM ME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGQEDEYLAESINKDIEECNAIIEQFIDYLRTGQEMQMEVAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+LGEV+A+ESGYEREIE+ L  G + +K+ PLSIKRAVAN+VVNAARYGNGWI+VSS
Sbjct  301  LNAILGEVVASESGYEREIESELAWGELPMKVSPLSIKRAVANLVVNAARYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI P Q  HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D HNG L
Sbjct  361  GRELQRAWFQVEDDGPGIDPSQLTHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHNGSL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTT  447
            ++G SERGGL +RA+LP+      G T
Sbjct  421  DVGASERGGLRVRAYLPLAFPNQSGAT  447


> UniRef100_C6CH25 Histidine kinase n=1 Tax=Dickeya zeae (strain 
Ech1591) RepID=C6CH25_DICZE
Length=470

 Score =  777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (83%), Positives = 411/447 (91%), Gaps = 0/447 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R RFSPRS+FARTLLLIVTLLF SLVTTYLVVLNFAILPS+QQFNKVLAYEVRMLMTD
Sbjct  1    MTRWRFSPRSAFARTLLLIVTLLFVSLVTTYLVVLNFAILPSMQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDG+ L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGSTLDVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR
Sbjct  121  EVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            +QNRPLV+LEHAA+QVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  VQNRPLVELEHAAIQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS++D YLAESINKDIEECNAIIEQFIDYLRTGQEM ME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSQEDEYLAESINKDIEECNAIIEQFIDYLRTGQEMQMEVAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+LGEV+A+ESGYEREI++ L  G + +K+ PLSIKRAVAN+VVNAARYGNGWI+VSS
Sbjct  301  LNAILGEVVASESGYEREIDSELARGELLMKVSPLSIKRAVANLVVNAARYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI P Q  HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D HNG L
Sbjct  361  GRELQRAWFQVEDDGPGIDPSQLAHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHNGSL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGTT  447
            ++G+SERGGL +RA+LP+      G +
Sbjct  421  DVGSSERGGLRVRAYLPLAFPNQAGVS  447


> UniRef100_UPI0003A9E8B8 osmolarity sensor protein n=1 Tax=Dickeya 
dianthicola RepID=UPI0003A9E8B8
Length=470

 Score =  776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/438 (85%), Positives = 408/438 (93%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R RFSPRS+FARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MIRWRFSPRSAFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDG+ L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGSTLDVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR
Sbjct  121  EVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            +QNRPLV+LEHAA+QVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  VQNRPLVELEHAAIQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS++D YLAESINKDIEECNAIIEQFIDYLRTGQEM ME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSQEDEYLAESINKDIEECNAIIEQFIDYLRTGQEMQMEVAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+LGEV+A+ESGYEREI++ L  G + +K+ PLSIKRAVAN+VVNAARYGNGWI+VSS
Sbjct  301  LNAILGEVVASESGYEREIDSELARGELLMKVSPLSIKRAVANLVVNAARYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G +  RAWFQVEDDGPGI P Q  HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D HNG L
Sbjct  361  GRDLQRAWFQVEDDGPGIDPSQLTHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHNGSL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            ++G SERGGL +RA+LP+
Sbjct  421  DVGASERGGLRVRAYLPL  438


> UniRef100_UPI0003A780B6 osmolarity sensor protein n=1 Tax=Dickeya 
zeae RepID=UPI0003A780B6
Length=470

 Score =  776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/446 (84%), Positives = 409/446 (91%), Gaps = 0/446 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R RFSPRS+FARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MIRWRFSPRSAFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDG+ L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGSTLDVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR
Sbjct  121  EVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            +QNRPLV+LEHAA+QVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  VQNRPLVELEHAAIQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM ++D YLAESINKDIEECNAIIEQFIDYLRTGQEM ME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGQEDEYLAESINKDIEECNAIIEQFIDYLRTGQEMQMEVAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+LGEV+A+ESGYEREI++ L  G + +K+ PLSIKRAVAN+VVNAARYGNGWI+VSS
Sbjct  301  LNAILGEVVASESGYEREIDSELTLGELPMKVSPLSIKRAVANLVVNAARYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI P Q  HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D HNG L
Sbjct  361  GRELQRAWFQVEDDGPGIDPSQLAHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHNGSL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQGT  446
            ++G SERGGL +RA+LP+      GT
Sbjct  421  DVGRSERGGLRVRAYLPLAFPNPSGT  446


> UniRef100_UPI0003A3478B osmolarity sensor protein n=1 Tax=Dickeya 
dianthicola RepID=UPI0003A3478B
Length=470

 Score =  776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/438 (85%), Positives = 408/438 (93%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R RFSPRS+FARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MIRWRFSPRSAFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDG+ L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGSTLDVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR
Sbjct  121  EVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            +QNRPLV+LEHAA+QVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  VQNRPLVELEHAAIQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS++D YLAESINKDIEECNAIIEQFIDYLRTGQEM ME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSQEDEYLAESINKDIEECNAIIEQFIDYLRTGQEMQMEVAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+LGEV+A+ESGYEREI++ L  G + +K+ PLSIKRAVAN+VVNAARYGNGWI+VSS
Sbjct  301  LNAILGEVVASESGYEREIDSELARGELLMKVSPLSIKRAVANLVVNAARYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G +  RAWFQVEDDGPGI P Q  HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D HNG L
Sbjct  361  GRDLQRAWFQVEDDGPGIDPSQLTHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHNGSL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            ++G SERGGL +RA+LP+
Sbjct  421  DVGASERGGLRVRAYLPL  438


> UniRef100_U6ZD14 Two-component osmolarity sensor protein n=1 
Tax=Dickeya sp. D s0432-1 RepID=U6ZD14_9ENTR
Length=468

 Score =  776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/445 (84%), Positives = 407/445 (91%), Gaps = 0/445 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R RFSPRS+FARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MIRWRFSPRSAFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDG+ L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGSTLDVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR
Sbjct  121  EVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            +QNRPLV+LEHAA+QVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  VQNRPLVELEHAAIQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM ++D YLAESINKDIEECNAIIEQFIDYLRTGQEM ME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGQEDEYLAESINKDIEECNAIIEQFIDYLRTGQEMQMEVAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+LGEV+A+ESGYEREI++ L  G + +K+ PLSIKRAVAN+VVNAARYGNGWI+VSS
Sbjct  301  LNAILGEVVASESGYEREIDSELARGELPMKVSPLSIKRAVANLVVNAARYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI P Q  HLFQPFVRGDSAR+ SGTGLGLAIVQRI+D HNG L
Sbjct  361  GRELQRAWFQVEDDGPGIDPSQLTHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHNGSL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRAQG  445
             +G SERGGL +RA+LP+      G
Sbjct  421  NVGASERGGLRVRAYLPLAFPNQSG  445


> UniRef100_O06468 EnvZ protein n=1 Tax=Yersinia enterocolitica 
RepID=O06468_YEREN
Length=450

 Score =  776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/440 (86%), Positives = 403/440 (91%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVK LADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMSE DGYL++SINKDIEECNAIIEQFIDYLRTGQEMP E +D
Sbjct  241  VSHDLRTPLTRIRLATEMMSEADGYLSDSINKDIEECNAIIEQFIDYLRTGQEMPTEPSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNAVLGEVIAAESGYER IET L  G + V +HPLSIKRA+ANMVVNAARY    IKVSS
Sbjct  301  LNAVLGEVIAAESGYERVIETDLCEGEVMVDIHPLSIKRALANMVVNAARYQKAKIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            GTE  RAWFQVEDDGP I PE   HLF PFVRGDSART  GTGLGLAIV RI+D H G L
Sbjct  361  GTELQRAWFQVEDDGPRIKPENLNHLFHPFVRGDSARTTIGTGLGLAIVHRIIDAHAGSL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            ++GTSERGGL IRA++P+P+
Sbjct  421  DIGTSERGGLRIRAYIPLPL  440


> UniRef100_C6C7Z5 Histidine kinase n=1 Tax=Dickeya dadantii (strain 
Ech703) RepID=C6C7Z5_DICDC
Length=452

 Score =  776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/438 (85%), Positives = 405/438 (92%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R RFSPRS+FARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MIRWRFSPRSAFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDG+ L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGSTLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            EVRVEV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR
Sbjct  121  EVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            +QNRPLV+LEHAA QVG+GIIPPPLREYGASEVRSVTRAFNHMAAGVK LADDRTLLMAG
Sbjct  181  VQNRPLVELEHAATQVGRGIIPPPLREYGASEVRSVTRAFNHMAAGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS++D YLAESINKDIEECNAIIEQFIDYLRTGQEM ME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSKEDDYLAESINKDIEECNAIIEQFIDYLRTGQEMQMEVAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN++LGEV+AAESGYER I++    G + V++ PLSIKRA  N+VVNA RYGNGWI+VSS
Sbjct  301  LNSILGEVVAAESGYERVIDSQFADGELTVRISPLSIKRAALNLVVNATRYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI P Q KHLFQPFVRGDSAR+ SGTGLGLAIVQRIVD HNG L
Sbjct  361  GRELQRAWFQVEDDGPGIDPLQLKHLFQPFVRGDSARSTSGTGLGLAIVQRIVDAHNGSL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            ++GTSERGGL IRA+LP+
Sbjct  421  DIGTSERGGLRIRAYLPL  438


> UniRef100_C5BGS5 Osmolarity sensor protein EnvZ, putative n=1 
Tax=Edwardsiella ictaluri (strain 93-146) RepID=C5BGS5_EDWI9
Length=461

 Score =  775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/436 (86%), Positives = 398/436 (91%), Gaps = 0/436 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQL VPPAFRREIYRELGISLY+N AAEE GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLEVPPAFRREIYRELGISLYTNSAAEENGLRWAQHYQFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVE++K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEISKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG IPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGKIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS QD YLAESINKD EECNAIIEQFIDYLRTGQEM  E  D
Sbjct  241  VSHDLRTPLTRIRLATEMMSPQDAYLAESINKDTEECNAIIEQFIDYLRTGQEMQTEACD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN +L EV+AAESGYEREI+T L  G + +  HPLSIKRAV NMVVNA RYGNGWIKVSS
Sbjct  301  LNGILTEVVAAESGYEREIDTDLANGELLIDAHPLSIKRAVVNMVVNATRYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI   Q  HLFQPFVRG+SART SGTGLGLAI+QRI+D H+G L
Sbjct  361  GMEGARAWFQVEDDGPGIDDAQLAHLFQPFVRGESARTTSGTGLGLAIIQRIIDAHHGSL  420

Query  421  ELGTSERGGLSIRAWL  436
            ++G SERGGL IRA+L
Sbjct  421  DIGRSERGGLKIRAYL  436


> UniRef100_D4FA97 ATPase/histidine kinase/DNA gyrase B/HSP90 domain 
protein n=2 Tax=Edwardsiella tarda RepID=D4FA97_EDWTA
Length=461

 Score =  775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/436 (86%), Positives = 400/436 (91%), Gaps = 0/436 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQL VPPAFRREIYRELGISLY+N AAEE GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLEVPPAFRREIYRELGISLYTNSAAEENGLRWAQHYQFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVE++K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEISKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG IPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGQIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +D YLAESINKD EECNAIIEQFIDYLRTGQEM  E  D
Sbjct  241  VSHDLRTPLTRIRLATEMMSPEDAYLAESINKDTEECNAIIEQFIDYLRTGQEMQTESCD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN +L EV+AAESGYEREI+TAL  G + +  HPLSIKRAV NMVVNAARYGNGWI+VSS
Sbjct  301  LNGILTEVVAAESGYEREIDTALAEGELLIDAHPLSIKRAVVNMVVNAARYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G +  RAW QVEDDGPGI  EQ  HLFQPFVRG+SART SGTGLGLAI+QRI+D H+G L
Sbjct  361  GRDGGRAWLQVEDDGPGIDDEQLAHLFQPFVRGESARTTSGTGLGLAIIQRIIDAHHGSL  420

Query  421  ELGTSERGGLSIRAWL  436
            ++G SERGGL IRA+L
Sbjct  421  DIGRSERGGLKIRAYL  436


> UniRef100_V3TRQ7 Uncharacterized protein n=1 Tax=Serratia sp. 
ATCC 39006 RepID=V3TRQ7_9ENTR
Length=456

 Score =  775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/438 (85%), Positives = 405/438 (92%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR  FSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRWYFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGT L VPPAFRREIYRELGISLY+N AAE++GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGTSLEVPPAFRREIYRELGISLYTNAAAEDSGLRWAQHYKFLSEQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR
Sbjct  121  DVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            +QNRPLV+LEHAA+QVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  VQNRPLVELEHAAIQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS+ D YLAESINKDIEECNAIIEQFIDYLRTGQEM ME+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSKDDDYLAESINKDIEECNAIIEQFIDYLRTGQEMQMEVAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN +LGEV+A+ESGYEREI++    G + V+  PLSIKRA  N+VVNAARYGNGWI+VSS
Sbjct  301  LNTILGEVVASESGYEREIDSHFSEGELLVRASPLSIKRAALNLVVNAARYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI P Q KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D HNG L
Sbjct  361  GRELQRAWFQVEDDGPGIEPAQLKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHNGGL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            ++GTSERGGLS+RA+LP+
Sbjct  421  DVGTSERGGLSVRAYLPL  438


> UniRef100_M4TMU2 Osmolarity sensor protein n=1 Tax=Edwardsiella 
tarda C07-087 RepID=M4TMU2_EDWTA
Length=461

 Score =  774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/459 (83%), Positives = 404/459 (88%), Gaps = 10/459 (2%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQL VPPAFRREIYRELGISLY+N AAEE GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLEVPPAFRREIYRELGISLYTNSAAEENGLRWAQHYQFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVE++K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEISKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG IPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGQIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS QD YLAESINKD EECNAIIEQFIDYLRTGQEM  E  D
Sbjct  241  VSHDLRTPLTRIRLATEMMSPQDAYLAESINKDTEECNAIIEQFIDYLRTGQEMQTEACD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN +L EV+AAESGYEREI+T L  G + +  HPLSIKRAV NMVVNA RYGNGWIKVSS
Sbjct  301  LNGILTEVVAAESGYEREIDTDLADGELLIDAHPLSIKRAVVNMVVNATRYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI      HLFQPFVRG+SART SGTGLGLAI+QRI+D H+G L
Sbjct  361  GMEGARAWFQVEDDGPGIDDAHLAHLFQPFVRGESARTTSGTGLGLAIIQRIIDAHHGSL  420

Query  421  ELGTSERGGLSIRAWL----------PVPVTRAQGTTKE  449
            ++G SERGGL IRA+L          P  V R+ G  KE
Sbjct  421  DIGRSERGGLKIRAYLRRVNMIAANAPDTVPRSGGRRKE  459


> UniRef100_D0ZG11 Osmolarity sensor protein n=2 Tax=Edwardsiella 
tarda RepID=D0ZG11_EDWTE
Length=461

 Score =  773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/436 (86%), Positives = 397/436 (91%), Gaps = 0/436 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KLQLEDGTQL VPPAFRREIYRELGISLY+N AAEE GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   KLQLEDGTQLEVPPAFRREIYRELGISLYTNSAAEENGLRWAQHYQFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVE++K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEISKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKG IPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGQIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS QD YLAESINKD EECNAIIEQFIDYLRTGQEM  E  D
Sbjct  241  VSHDLRTPLTRIRLATEMMSPQDAYLAESINKDTEECNAIIEQFIDYLRTGQEMQTEACD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN +L EV+AAESGYEREI+T L  G + +  HPLSIKRAV NMVVNA RYGNGWIKVSS
Sbjct  301  LNGILTEVVAAESGYEREIDTDLADGELLIDAHPLSIKRAVVNMVVNATRYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDGPGI      HLFQPFVRG+SART SGTGLGLAI+QRI+D H+G L
Sbjct  361  GMEGARAWFQVEDDGPGIDDAHLAHLFQPFVRGESARTTSGTGLGLAIIQRIIDAHHGSL  420

Query  421  ELGTSERGGLSIRAWL  436
            ++G SERGGL IRA+L
Sbjct  421  DIGRSERGGLKIRAYL  436


> UniRef100_UPI00034A8282 osmolarity sensor protein n=1 Tax=Serratia 
marcescens RepID=UPI00034A8282
Length=440

 Score =  770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/431 (85%), Positives = 399/431 (92%), Gaps = 0/431 (0%)

Query  17   LLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAF  76
            +LIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD+LQLEDGT L VPPAF
Sbjct  1    MLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQLEDGTLLEVPPAF  60

Query  77   RREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLK  136
            RREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VRVEVNK+SPVVWLK
Sbjct  61   RREIYRELGISLYTNSAAEESGLRWAQHYQFLSQQMAQQLGGPTDVRVEVNKNSPVVWLK  120

Query  137  TWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQV  196
            TWL P+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLV+LEHAALQV
Sbjct  121  TWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVELEHAALQV  180

Query  197  GKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLAT  256
            GKGIIPPPLREYGASEVRSVTRAFN MA+GVKQLADDRTLLMAGVSHDLRTPLTRIRLAT
Sbjct  181  GKGIIPPPLREYGASEVRSVTRAFNQMASGVKQLADDRTLLMAGVSHDLRTPLTRIRLAT  240

Query  257  EMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYE  316
            EMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEMP E +DLNA+LGEV+AAESGYE
Sbjct  241  EMMSAEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPTESSDLNAILGEVVAAESGYE  300

Query  317  REIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGP  376
            R IETAL PG + + +HPLSIKRA  NMVVNAARYGNGWIKVSSG E  R WFQVEDDGP
Sbjct  301  RVIETALSPGELMMNVHPLSIKRAAVNMVVNAARYGNGWIKVSSGRELQRGWFQVEDDGP  360

Query  377  GIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWL  436
            GI PE+ KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H+G L++GTSERGGL IRA++
Sbjct  361  GIKPEELKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHDGELDIGTSERGGLLIRAYI  420

Query  437  PVPVTRAQGTT  447
            P+P+ + + T 
Sbjct  421  PLPMEKKESTN  431


> UniRef100_G7LV48 Integral membrane sensor signal transduction 
histidine kinase n=1 Tax=Brenneria sp. EniD312 RepID=G7LV48_9ENTR
Length=453

 Score =  770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/452 (82%), Positives = 408/452 (90%), Gaps = 3/452 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MIRWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
             LQLEDG+ L VPPAFRREIYRELGISLY+NEAAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   SLQLEDGSTLEVPPAFRREIYRELGISLYTNEAAEESGLRWAQHYKFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR
Sbjct  121  DVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            +QNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  VQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS++D YLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSKEDDYLAESINKDIEECNAIIEQFIDYLRTGQEMQTEAAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA++GEV+AAE+GYER+I++    G + V++ PLSIKRA  N+VVNAARYGNGWIKVS+
Sbjct  301  LNAIMGEVVAAETGYERQIDSNFASGELLVRVSPLSIKRAALNLVVNAARYGNGWIKVST  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  RAWFQVEDDG GI P   KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H+G+L
Sbjct  361  GRELQRAWFQVEDDGSGIEPALLKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHDGVL  420

Query  421  ELGTSERGGLSIRAWLPVPVTRA---QGTTKE  449
            ++G SERGGL +RA+LP+P   A    G  KE
Sbjct  421  DVGVSERGGLCVRAYLPLPFDIAAPESGAAKE  452


> UniRef100_UPI0001A44618 osmolarity sensor protein n=1 Tax=Pectobacterium 
carotovorum RepID=UPI0001A44618
Length=452

 Score =  767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/434 (84%), Positives = 402/434 (92%), Gaps = 0/434 (0%)

Query  5    RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQL  64
            RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD LQL
Sbjct  4    RFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDSLQL  63

Query  65   EDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRV  124
            EDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VRV
Sbjct  64   EDGTTLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPTDVRV  123

Query  125  EVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNR  184
            EV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR+QNR
Sbjct  124  EVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIRVQNR  183

Query  185  PLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHD  244
            PLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAGVSHD
Sbjct  184  PLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAGVSHD  243

Query  245  LRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAV  304
            LRTPLTRIRLATEMM ++D YLAESINKDIEECNAIIEQF+DYLRTGQEM  E+ADLNA+
Sbjct  244  LRTPLTRIRLATEMMGKEDDYLAESINKDIEECNAIIEQFLDYLRTGQEMQTEVADLNAI  303

Query  305  LGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEP  364
            +GEV+A+ESGYER+I++    G + V++  LSIKRA  N+VVNAARYGNGWIKVS+G E 
Sbjct  304  MGEVVASESGYERQIDSEFATGELLVRISSLSIKRAALNLVVNAARYGNGWIKVSTGREL  363

Query  365  NRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGT  424
             R WFQVEDDG GIAP+Q KHLFQPFVRGDSART SGTGLGLAIVQRI+D HNG+L++G+
Sbjct  364  QRVWFQVEDDGEGIAPDQLKHLFQPFVRGDSARTTSGTGLGLAIVQRIIDAHNGVLDVGS  423

Query  425  SERGGLSIRAWLPV  438
            SERGGL +RA+LP+
Sbjct  424  SERGGLCVRAYLPL  437


> UniRef100_W0HNQ5 Osmolarity sensor protein 2-component sensor 
kinase n=1 Tax=Sodalis sp. HS1 RepID=W0HNQ5_9ENTR
Length=460

 Score =  766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/440 (84%), Positives = 400/440 (90%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R R SPRSSFAR+LLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MMRWRISPRSSFARSLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVPPAFRREIYRELGISLYTNPAAEESGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEV K+SPVVWLKTWLSP+IWVR+PLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVTKNSPVVWLKTWLSPDIWVRIPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFN M AGVK LADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMTAGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSAEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTETAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN++L EV+AAESGYER IET +    + V ++PLSIKRA  NMVVNAARYGNGWIKV+S
Sbjct  301  LNSILTEVVAAESGYERVIETDICGEELIVNVNPLSIKRAALNMVVNAARYGNGWIKVNS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G + NR WF+VEDDGPGI P+Q ++LFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GRDTNRVWFEVEDDGPGIKPDQLQYLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGKL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            E+G S R GL IRA+LP+PV
Sbjct  421  EIGRSARQGLRIRAYLPLPV  440


> UniRef100_C6DGE9 Histidine kinase n=1 Tax=Pectobacterium carotovorum 
subsp. carotovorum (strain PC1) RepID=C6DGE9_PECCP
Length=453

 Score =  765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/438 (83%), Positives = 404/438 (92%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M + RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MMQWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
             LQLEDG+ L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   SLQLEDGSTLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR
Sbjct  121  DVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            +QNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  VQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM ++D YLAESINKDIEECNAIIEQF+DYLRTGQEM  E+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGKEDDYLAESINKDIEECNAIIEQFLDYLRTGQEMQTEVAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA++GEV+A+ESGYER+I++    G + V++  LSIKRA  N+VVNAARYGNGWIKVS+
Sbjct  301  LNAIMGEVVASESGYERQIDSEFATGELLVRISSLSIKRAALNLVVNAARYGNGWIKVST  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G +  R WFQVEDDG GIAP+Q KHLFQPFVRGDSART SGTGLGLAIVQRI+D HNG+L
Sbjct  361  GRDLQRVWFQVEDDGEGIAPDQLKHLFQPFVRGDSARTTSGTGLGLAIVQRIIDAHNGVL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            ++G+SERGGL +RA+LP+
Sbjct  421  DVGSSERGGLCVRAYLPL  438


> UniRef100_C4T143 Osmolarity sensor protein envZ n=1 Tax=Yersinia 
intermedia ATCC 29909 RepID=C4T143_YERIN
Length=431

 Score =  765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/421 (88%), Positives = 394/421 (93%), Gaps = 0/421 (0%)

Query  20   VTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRRE  79
            +TLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD+LQLEDGT L VPPAFRRE
Sbjct  1    MTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQLEDGTLLEVPPAFRRE  60

Query  80   IYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWL  139
            IYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VRVEVNK+SPVVWLKTWL
Sbjct  61   IYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPTDVRVEVNKNSPVVWLKTWL  120

Query  140  SPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKG  199
            SP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIRIQNRPLV+LEHAALQVGKG
Sbjct  121  SPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIRIQNRPLVELEHAALQVGKG  180

Query  200  IIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMM  259
            IIPPPLREYGASEVRSVTRAFN MAAGVK LADDRTLLMAGVSHDLRTPLTRIRLATEMM
Sbjct  181  IIPPPLREYGASEVRSVTRAFNQMAAGVKLLADDRTLLMAGVSHDLRTPLTRIRLATEMM  240

Query  260  SEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREI  319
            SE DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +DLNAVLGEVIAAESGYER I
Sbjct  241  SEADGYLSESINKDIEECNAIIEQFIDYLRTGQEMPTESSDLNAVLGEVIAAESGYERII  300

Query  320  ETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIA  379
            ET L  G + V +HPLSIKRA+ANMVVNAARYGNGWIKVSSGTE  RAWFQVEDDGPGI 
Sbjct  301  ETDLCAGEVLVDIHPLSIKRALANMVVNAARYGNGWIKVSSGTELQRAWFQVEDDGPGIK  360

Query  380  PEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVP  439
            PE  KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L++GTSERGGL IRA++P+P
Sbjct  361  PEDLKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSLDIGTSERGGLRIRAYIPLP  420

Query  440  V  440
            +
Sbjct  421  L  421


> UniRef100_J8T1Z7 Osmolarity sensor protein n=1 Tax=Pectobacterium 
wasabiae CFBP 3304 RepID=J8T1Z7_9ENTR
Length=453

 Score =  765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/438 (83%), Positives = 403/438 (92%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M + RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MMQWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
             LQLEDG+ L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   SLQLEDGSTLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR
Sbjct  121  DVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            +QNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  VQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM ++D YLAESINKDIEECNAIIEQF+DYLRTGQEM  E+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGKEDDYLAESINKDIEECNAIIEQFLDYLRTGQEMQTEVAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA++GEV+A+ESGYER+I++    G + V++  LSIKRA  N+VVNAARYGNGWIKVS+
Sbjct  301  LNAIMGEVVASESGYERQIDSEFATGELLVRISSLSIKRAAMNLVVNAARYGNGWIKVST  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  R WFQVEDDG GIA +Q +HLFQPFVRGDSART SGTGLGLAIVQRI+D HNG+L
Sbjct  361  GRELQRVWFQVEDDGEGIATDQLQHLFQPFVRGDSARTTSGTGLGLAIVQRIIDAHNGVL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            ++GTSERGGL +RA+LP+
Sbjct  421  DVGTSERGGLCVRAYLPL  438


> UniRef100_C4U8R2 Osmolarity sensor protein envZ n=1 Tax=Yersinia 
aldovae ATCC 35236 RepID=C4U8R2_YERAL
Length=431

 Score =  764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/421 (87%), Positives = 394/421 (93%), Gaps = 0/421 (0%)

Query  20   VTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRRE  79
            +TLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD+LQLEDGT L VPPAFRRE
Sbjct  1    MTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQLEDGTLLEVPPAFRRE  60

Query  80   IYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWL  139
            IYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VRVEVNK+SPVVWLKTWL
Sbjct  61   IYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPTDVRVEVNKNSPVVWLKTWL  120

Query  140  SPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKG  199
            SP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIRIQNRPLV+LEHAA+QVGKG
Sbjct  121  SPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIRIQNRPLVELEHAAMQVGKG  180

Query  200  IIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMM  259
            IIPPPLREYGASEVRSVTRAFN MAAGVK LADDRTLLMAGVSHDLRTPLTRIRLATEMM
Sbjct  181  IIPPPLREYGASEVRSVTRAFNQMAAGVKLLADDRTLLMAGVSHDLRTPLTRIRLATEMM  240

Query  260  SEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREI  319
            SE DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +DLNAVLGEVIAAESGYER I
Sbjct  241  SEADGYLSESINKDIEECNAIIEQFIDYLRTGQEMPTESSDLNAVLGEVIAAESGYERVI  300

Query  320  ETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIA  379
            ET L  G + V +HPLSIKRA+ANMVVNAARYGNGWIKVSSGTE  RAWFQVEDDGPGI 
Sbjct  301  ETDLCAGEVLVDIHPLSIKRALANMVVNAARYGNGWIKVSSGTELQRAWFQVEDDGPGIK  360

Query  380  PEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVP  439
            PE  KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L++GTSERGGL IRA++P+P
Sbjct  361  PEDLKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSLDIGTSERGGLRIRAYIPLP  420

Query  440  V  440
            +
Sbjct  421  L  421


> UniRef100_D0KBD1 Integral membrane sensor signal transduction 
histidine kinase n=2 Tax=Pectobacterium RepID=D0KBD1_PECWW
Length=453

 Score =  764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/438 (83%), Positives = 403/438 (92%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M + RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MMQWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
             LQLEDG+ L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT
Sbjct  61   SLQLEDGSTLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR
Sbjct  121  DVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            +QNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAG
Sbjct  181  VQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM ++D YLAESINKDIEECNAIIEQF+DYLRTGQEM  E+AD
Sbjct  241  VSHDLRTPLTRIRLATEMMGKEDDYLAESINKDIEECNAIIEQFLDYLRTGQEMQTEVAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA++GEV+A+ESGYER+I++    G + V++  LSIKRA  N+VVNAARYGNGWIKVS+
Sbjct  301  LNAIMGEVVASESGYERQIDSEFATGELLVRISSLSIKRAAMNLVVNAARYGNGWIKVST  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  R WFQVEDDG GIA +Q +HLFQPFVRGDSART SGTGLGLAIVQRI+D HNG+L
Sbjct  361  GRELQRVWFQVEDDGEGIATDQLQHLFQPFVRGDSARTTSGTGLGLAIVQRIIDAHNGVL  420

Query  421  ELGTSERGGLSIRAWLPV  438
            ++GTSERGGL +RA+LP+
Sbjct  421  DVGTSERGGLCVRAYLPL  438


> UniRef100_R9NUM4 Osmolarity sensor protein n=1 Tax=Erwinia tracheiphila 
PSU-1 RepID=R9NUM4_9ENTR
Length=450

 Score =  763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/439 (88%), Positives = 412/439 (93%), Gaps = 0/439 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRR+RFSPRSSFARTLLLI+TLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRIRFSPRSSFARTLLLIITLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGTQL VP AFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   RLQLEDGTQLEVPLAFRREIYRELGISLYTNTAAEESGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEVNK+SPVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MAAGVKQLADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS+QDGYLAESINKDIEECNAIIEQFIDYLRTGQE+  E AD
Sbjct  241  VSHDLRTPLTRIRLATEMMSQQDGYLAESINKDIEECNAIIEQFIDYLRTGQEIQTERAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN+VLGEV+AAESGYEREIE A+ P  + + ++PLSIKRA ANMVVNAARYGNGWIKVSS
Sbjct  301  LNSVLGEVVAAESGYEREIENAVMPAELLLDINPLSIKRAAANMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G EP RAWFQVEDDGPGIAP Q KHL QPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GREPERAWFQVEDDGPGIAPNQLKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHQGTL  420

Query  421  ELGTSERGGLSIRAWLPVP  439
            E+G SERGGL IRA+LP+P
Sbjct  421  EIGESERGGLCIRAYLPLP  439


> UniRef100_C4U2B3 Osmolarity sensor protein envZ n=1 Tax=Yersinia 
kristensenii ATCC 33638 RepID=C4U2B3_YERKR
Length=431

 Score =  763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/421 (88%), Positives = 394/421 (93%), Gaps = 0/421 (0%)

Query  20   VTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRRE  79
            +TLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD+LQLEDGT L VPPAFRRE
Sbjct  1    MTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQLEDGTLLEVPPAFRRE  60

Query  80   IYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWL  139
            IYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VRVEVNK+SPVVWLKTWL
Sbjct  61   IYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPTDVRVEVNKNSPVVWLKTWL  120

Query  140  SPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKG  199
            SP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIRIQNRPLV+LEHAALQVGKG
Sbjct  121  SPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIRIQNRPLVELEHAALQVGKG  180

Query  200  IIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMM  259
            IIPPPLREYGASEVRSVTRAFN MAAGVK LADDRTLLMAGVSHDLRTPLTRIRLATEMM
Sbjct  181  IIPPPLREYGASEVRSVTRAFNQMAAGVKLLADDRTLLMAGVSHDLRTPLTRIRLATEMM  240

Query  260  SEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREI  319
            SE DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +DLNAVLGEVIAAESGYER I
Sbjct  241  SEADGYLSESINKDIEECNAIIEQFIDYLRTGQEMPTEPSDLNAVLGEVIAAESGYERVI  300

Query  320  ETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIA  379
            ET L  G + V +HPLSIKRA+ANMVVNAARYGNGWIKVSSGTE  RAWFQVEDDGPGI 
Sbjct  301  ETDLCEGEVIVDIHPLSIKRALANMVVNAARYGNGWIKVSSGTELQRAWFQVEDDGPGIK  360

Query  380  PEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVP  439
            PE  KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L++GTSERGGL IRA++P+P
Sbjct  361  PEDLKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSLDIGTSERGGLRIRAYIPLP  420

Query  440  V  440
            +
Sbjct  421  L  421


> UniRef100_C4SQE9 Osmolarity sensor protein envZ n=1 Tax=Yersinia 
frederiksenii ATCC 33641 RepID=C4SQE9_YERFR
Length=434

 Score =  763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/421 (88%), Positives = 394/421 (93%), Gaps = 0/421 (0%)

Query  20   VTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRRE  79
            +TLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD+LQLEDGT L VPPAFRRE
Sbjct  1    MTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQLEDGTLLEVPPAFRRE  60

Query  80   IYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWL  139
            IYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VRVEVNK+SPVVWLKTWL
Sbjct  61   IYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPTDVRVEVNKNSPVVWLKTWL  120

Query  140  SPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKG  199
            SP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIRIQNRPLV+LEHAALQVGKG
Sbjct  121  SPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIRIQNRPLVELEHAALQVGKG  180

Query  200  IIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMM  259
            IIPPPLREYGASEVRSVTRAFN MAAGVK LADDRTLLMAGVSHDLRTPLTRIRLATEMM
Sbjct  181  IIPPPLREYGASEVRSVTRAFNQMAAGVKLLADDRTLLMAGVSHDLRTPLTRIRLATEMM  240

Query  260  SEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREI  319
            SE DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +DLNAVLGEVIAAESGYER I
Sbjct  241  SEADGYLSESINKDIEECNAIIEQFIDYLRTGQEMPTEPSDLNAVLGEVIAAESGYERVI  300

Query  320  ETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIA  379
            ET L  G + V +HPLSIKRA+ANMVVNAARYGNGWIKVSSGTE  RAWFQVEDDGPGI 
Sbjct  301  ETDLCEGEVMVDIHPLSIKRALANMVVNAARYGNGWIKVSSGTELQRAWFQVEDDGPGIK  360

Query  380  PEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVP  439
            PE  KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L++GTSERGGL IRA++P+P
Sbjct  361  PEDLKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSLDIGTSERGGLRIRAYIPLP  420

Query  440  V  440
            +
Sbjct  421  L  421


> UniRef100_C4UUM8 Osmolarity sensor protein envZ n=1 Tax=Yersinia 
rohdei ATCC 43380 RepID=C4UUM8_YERRO
Length=434

 Score =  763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/421 (87%), Positives = 393/421 (93%), Gaps = 0/421 (0%)

Query  20   VTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRRE  79
            +TLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD+LQLEDGT L VPPAFRRE
Sbjct  1    MTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQLEDGTLLEVPPAFRRE  60

Query  80   IYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWL  139
            IYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VRVEVNK+SPVVWLKTWL
Sbjct  61   IYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPTDVRVEVNKNSPVVWLKTWL  120

Query  140  SPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKG  199
            SP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIRIQNRPLV+LEHAA+QVGKG
Sbjct  121  SPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIRIQNRPLVELEHAAVQVGKG  180

Query  200  IIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMM  259
            IIPPPLREYGASEVRSVTRAFN MAAGVK LADDRTLLMAGVSHDLRTPLTRIRLATEMM
Sbjct  181  IIPPPLREYGASEVRSVTRAFNQMAAGVKLLADDRTLLMAGVSHDLRTPLTRIRLATEMM  240

Query  260  SEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREI  319
            SE DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +DLNAVLGEVIAAESGYER I
Sbjct  241  SEADGYLSESINKDIEECNAIIEQFIDYLRTGQEMPTESSDLNAVLGEVIAAESGYERVI  300

Query  320  ETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIA  379
            ET L  G + V +HPLSIKRA+ANMVVNAARYGNGWIKVSSGTE  RAWFQVEDDGPGI 
Sbjct  301  ETDLCDGEVMVDIHPLSIKRALANMVVNAARYGNGWIKVSSGTELQRAWFQVEDDGPGIK  360

Query  380  PEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVP  439
            PE  KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G LE+G SERGGL IRA++P+P
Sbjct  361  PEDLKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSLEIGASERGGLRIRAYIPLP  420

Query  440  V  440
            +
Sbjct  421  L  421


> UniRef100_J7L4A8 EnvZ protein n=2 Tax=Pectobacterium carotovorum 
RepID=J7L4A8_PECCC
Length=452

 Score =  762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/434 (83%), Positives = 401/434 (92%), Gaps = 0/434 (0%)

Query  5    RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQL  64
            RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD LQL
Sbjct  4    RFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDSLQL  63

Query  65   EDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRV  124
            EDG+ L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VRV
Sbjct  64   EDGSTLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPTDVRV  123

Query  125  EVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNR  184
            EV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR+QNR
Sbjct  124  EVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIRVQNR  183

Query  185  PLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHD  244
            PLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAGVSHD
Sbjct  184  PLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAGVSHD  243

Query  245  LRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAV  304
            LRTPLTRIRLATEMM ++D YLAESINKDIEECNAIIEQF+DYLRTGQEM  E+ADLNA+
Sbjct  244  LRTPLTRIRLATEMMGKEDDYLAESINKDIEECNAIIEQFLDYLRTGQEMQTEVADLNAI  303

Query  305  LGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEP  364
            +GEV+A+ESGYER+I++    G + V++  LSIKRA  N+VVNAARYGNGWIKVS+G E 
Sbjct  304  MGEVVASESGYERQIDSDFATGELLVRISSLSIKRAALNLVVNAARYGNGWIKVSTGREL  363

Query  365  NRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGT  424
             R WFQVEDDG GIAP+Q +HLFQPFVRGDSART SGTGLGLAIVQRI+D HNG+L++G 
Sbjct  364  QRVWFQVEDDGEGIAPDQLQHLFQPFVRGDSARTTSGTGLGLAIVQRIIDAHNGVLDVGR  423

Query  425  SERGGLSIRAWLPV  438
            SERGGL +RA+LP+
Sbjct  424  SERGGLCVRAYLPL  437


> UniRef100_C4RXN2 Osmolarity sensor protein envZ n=1 Tax=Yersinia 
bercovieri ATCC 43970 RepID=C4RXN2_YERBE
Length=429

 Score =  761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/418 (88%), Positives = 392/418 (93%), Gaps = 0/418 (0%)

Query  20   VTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRRE  79
            +TLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD+LQLEDGT L VPPAFRRE
Sbjct  1    MTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQLEDGTLLEVPPAFRRE  60

Query  80   IYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWL  139
            IYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VRVEVNK+SPVVWLKTWL
Sbjct  61   IYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPTDVRVEVNKNSPVVWLKTWL  120

Query  140  SPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKG  199
            SP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIRIQNRPLV+LEHAALQVGKG
Sbjct  121  SPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIRIQNRPLVELEHAALQVGKG  180

Query  200  IIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMM  259
            IIPPPLREYGASEVRSVTRAFN MAAGVK LADDRTLLMAGVSHDLRTPLTRIRLATEMM
Sbjct  181  IIPPPLREYGASEVRSVTRAFNQMAAGVKLLADDRTLLMAGVSHDLRTPLTRIRLATEMM  240

Query  260  SEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREI  319
            SE DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMP E +DLN+VLGEVIAAESGYER I
Sbjct  241  SEADGYLSESINKDIEECNAIIEQFIDYLRTGQEMPTEPSDLNSVLGEVIAAESGYERVI  300

Query  320  ETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIA  379
            ET L  G + V +HPLSIKRA+ANMVVNAARYGNGWIKVSSGTE  RAWFQVEDDGPGI 
Sbjct  301  ETDLCAGEVLVDIHPLSIKRALANMVVNAARYGNGWIKVSSGTELQRAWFQVEDDGPGIK  360

Query  380  PEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLP  437
            PE+ KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L++GTSERGGL IRA++P
Sbjct  361  PEELKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSLDIGTSERGGLRIRAYIP  418


> UniRef100_C4UH24 Osmolarity sensor protein envZ n=1 Tax=Yersinia 
ruckeri ATCC 29473 RepID=C4UH24_YERRU
Length=432

 Score =  761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/427 (85%), Positives = 399/427 (93%), Gaps = 0/427 (0%)

Query  20   VTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRRE  79
            +TLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD+LQLEDGT L VPPAFRRE
Sbjct  1    MTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQLEDGTLLEVPPAFRRE  60

Query  80   IYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWL  139
            IYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VRVEV+K+SPVVWLKTWL
Sbjct  61   IYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPTDVRVEVSKNSPVVWLKTWL  120

Query  140  SPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKG  199
            SP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIRIQNRPLV+LEHAALQVGKG
Sbjct  121  SPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIRIQNRPLVELEHAALQVGKG  180

Query  200  IIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMM  259
             IPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAGVSHDLRTPLTRIRLATEMM
Sbjct  181  NIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAGVSHDLRTPLTRIRLATEMM  240

Query  260  SEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREI  319
            +E+DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMP EM++LNA+LGEVIAAESGYEREI
Sbjct  241  AEEDGYLSESINKDIEECNAIIEQFIDYLRTGQEMPTEMSELNAILGEVIAAESGYEREI  300

Query  320  ETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIA  379
            ET L    + V++HPLSIKRA+ANMVVNAARYGNGWIKVSSGTE  RAWFQVEDDGPGI 
Sbjct  301  ETDLCDEEVLVEVHPLSIKRALANMVVNAARYGNGWIKVSSGTELQRAWFQVEDDGPGIK  360

Query  380  PEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVP  439
            PE+ KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H+GML++GTS++GGL IRA+LP+ 
Sbjct  361  PEELKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHSGMLDIGTSDKGGLRIRAYLPLS  420

Query  440  VTRAQGT  446
            +     T
Sbjct  421  LDVKSST  427


> UniRef100_Q6CZP4 Two-component osmolarity sensor protein n=1 
Tax=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) 
RepID=Q6CZP4_PECAS
Length=452

 Score =  761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/434 (83%), Positives = 400/434 (92%), Gaps = 0/434 (0%)

Query  5    RFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQL  64
            RFSPRSSFARTLLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD LQL
Sbjct  4    RFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDSLQL  63

Query  65   EDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRV  124
            EDG+ L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VRV
Sbjct  64   EDGSTLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPTDVRV  123

Query  125  EVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNR  184
            EV+K++PVVWLKTWLSP+IWVRVPLTEIHQGDFSPLFRYTLAIMLL IGGAWLFIR+QNR
Sbjct  124  EVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIRVQNR  183

Query  185  PLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHD  244
            PLV+LEHAALQVGKGIIPPPLREYGASEVRSVTRAFN MA+GVK LADDRTLLMAGVSHD
Sbjct  184  PLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAGVSHD  243

Query  245  LRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAV  304
            LRTPLTRIRLATEMM ++D YLAESINKDIEECNAIIEQF+DYLRTGQEM  E+ADLNA+
Sbjct  244  LRTPLTRIRLATEMMGKEDDYLAESINKDIEECNAIIEQFLDYLRTGQEMQTEVADLNAI  303

Query  305  LGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEP  364
            +GEV+A+ESGYER+I++    G + V++  LSIKRA  N+VVNA RYGNGWIKVS+G E 
Sbjct  304  MGEVVASESGYERQIDSEFATGELLVRISSLSIKRAALNLVVNATRYGNGWIKVSTGREL  363

Query  365  NRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGT  424
             R WFQVEDDG GIA +Q +HLFQPFVRGDSART SGTGLGLAIVQRI+D HNG+L++GT
Sbjct  364  QRIWFQVEDDGEGIAADQLQHLFQPFVRGDSARTTSGTGLGLAIVQRIIDAHNGVLDVGT  423

Query  425  SERGGLSIRAWLPV  438
            SERGGL +RA+LP+
Sbjct  424  SERGGLCVRAYLPL  437


> UniRef100_W0HH31 Osmolarity sensory histidine kinase EnvZ n=1 
Tax=Candidatus Sodalis pierantonius str. SOPE RepID=W0HH31_9ENTR
Length=441

 Score =  760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/440 (84%), Positives = 399/440 (90%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R R SPRSSFAR+LLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MMRWRISPRSSFARSLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L V PAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMAQQLGGPT
Sbjct  61   RLQLEDGTLLEVSPAFRREIYRELGISLYTNPAAEESGLRWAQHYEFLSQQMAQQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEV K+SPVVWLKTWLSP+IWVR+PLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVIKNSPVVWLKTWLSPDIWVRIPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFN M AGVK LADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMTAGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  EMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSAEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN++L EV+AAESGYER IET +    + V ++PLSIKRA  NMVVNAARYGNGWIKV+S
Sbjct  301  LNSILTEVVAAESGYERVIETDICGEELIVNVNPLSIKRAALNMVVNAARYGNGWIKVNS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G + NR WF+VEDDGPGI P+Q ++LFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GRDTNRVWFEVEDDGPGIKPDQLQYLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGKL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            E+G S R GL IRA LP+PV
Sbjct  421  EIGRSARQGLRIRANLPLPV  440


> UniRef100_Q2NQI2 Two-component sensor kinase n=1 Tax=Sodalis 
glossinidius (strain morsitans) RepID=Q2NQI2_SODGM
Length=460

 Score =  759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/440 (84%), Positives = 398/440 (90%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M R R SPRSSFAR+LLLIVTLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MMRWRISPRSSFARSLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISLY+N AAEE+GLRWAQHYEFLS QMAQQLG PT
Sbjct  61   QLQLEDGTLLEVPPAFRREIYRELGISLYTNPAAEESGLRWAQHYEFLSQQMAQQLGSPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEV K+SPVVWLKTWLSP+IWVR+PLTEIHQG FSPLFRYTLAIMLLAIGGAWLFIR
Sbjct  121  DVRVEVTKNSPVVWLKTWLSPDIWVRIPLTEIHQGGFSPLFRYTLAIMLLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFN M AGVK LADDRTLLMAG
Sbjct  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQMTAGVKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTGQEM  EMAD
Sbjct  241  VSHDLRTPLTRIRLATEMMSAEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMQTEMAD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN++L EV+AAESGYER IET +    + V ++PLSIKRA  NMVVNAARYGNG IKV+S
Sbjct  301  LNSILTEVVAAESGYERVIETDICGEELIVNVNPLSIKRAALNMVVNAARYGNGCIKVNS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E NR WF+VEDDGPGI P+Q ++LFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L
Sbjct  361  GRETNRVWFEVEDDGPGIQPDQLQYLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGKL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            E+G S R GL IRA+LP+PV
Sbjct  421  EIGRSARQGLRIRAYLPLPV  440


> UniRef100_C4SCQ6 Osmolarity sensor protein envZ n=1 Tax=Yersinia 
mollaretii ATCC 43969 RepID=C4SCQ6_YERMO
Length=429

 Score =  759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/418 (88%), Positives = 392/418 (93%), Gaps = 0/418 (0%)

Query  20   VTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRRE  79
            +TLLF SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD+LQLEDGT L VPPAFRRE
Sbjct  1    MTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQLEDGTLLEVPPAFRRE  60

Query  80   IYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWL  139
            IYRELGISLY+N AAEE+GLRWAQHY+FLS QMAQQLGGPT+VRVEVNK+SPVVWLKTWL
Sbjct  61   IYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPTDVRVEVNKNSPVVWLKTWL  120

Query  140  SPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKG  199
            SP+IWVRVPLTEIHQGDFSPLFRYTLAIMLLA+GGAWLFIRIQNRPLV+LEHAALQVGKG
Sbjct  121  SPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIRIQNRPLVELEHAALQVGKG  180

Query  200  IIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMM  259
            IIPPPLREYGASEVRSVTRAFN MAAGVK LADDRTLLMAGVSHDLRTPLTRIRLATEMM
Sbjct  181  IIPPPLREYGASEVRSVTRAFNQMAAGVKLLADDRTLLMAGVSHDLRTPLTRIRLATEMM  240

Query  260  SEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREI  319
            SE DGYL+ESINKDIEECNAIIEQFIDYLRTGQEMP E ++LN+VLGEVIAAESGYER I
Sbjct  241  SEADGYLSESINKDIEECNAIIEQFIDYLRTGQEMPTEPSELNSVLGEVIAAESGYERVI  300

Query  320  ETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIA  379
            ET L  G + V +HPLSIKRA+ANMVVNAARYGNGWIKVSSGTE  RAWFQVEDDGPGI 
Sbjct  301  ETDLCEGEVLVDIHPLSIKRALANMVVNAARYGNGWIKVSSGTELQRAWFQVEDDGPGIK  360

Query  380  PEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLP  437
            PE+ KHLFQPFVRGDSAR+ SGTGLGLAIVQRI+D H G L++GTSERGGL IRA++P
Sbjct  361  PEELKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSLDIGTSERGGLRIRAYIP  418


> UniRef100_E9CMX7 Putative sensory histidine kinase in two-component 
regulatory system with OmpR n=1 Tax=Serratia symbiotica 
str. Tucson RepID=E9CMX7_9ENTR
Length=459

 Score =  756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/440 (85%), Positives = 407/440 (92%), Gaps = 0/440 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MRRLRFSP SSFARTLLLI+TLL  SLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
Sbjct  1    MRRLRFSPCSSFARTLLLIITLLIVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +LQLEDGT L VPPAFRREIYRELGISL +N AAEE GLRWAQHY FLS QMA QLGGPT
Sbjct  61   RLQLEDGTVLPVPPAFRREIYRELGISLCTNSAAEENGLRWAQHYHFLSQQMAHQLGGPT  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VRVEV+K+SPVVWLKTWL P+IWVRVPLTEIHQGDFSPLFRYTLAI+LLAIGGAWLFIR
Sbjct  121  DVRVEVDKNSPVVWLKTWLQPDIWVRVPLTEIHQGDFSPLFRYTLAIILLAIGGAWLFIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
            IQNRPLV+LEHAALQVG+GIIPPPLREYGASEV SVTRAFN MA+G+K LADDRTLLMAG
Sbjct  181  IQNRPLVELEHAALQVGRGIIPPPLREYGASEVLSVTRAFNQMASGIKLLADDRTLLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +DGYLAESINKDIEECNAIIEQFIDYLRTG EMP+E +D
Sbjct  241  VSHDLRTPLTRIRLATEMMSVEDGYLAESINKDIEECNAIIEQFIDYLRTGHEMPIETSD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+LGEV+AAESGYER IETA+ PG++ V +HPLSIKRA  NMVVNAARYGNGWIKVSS
Sbjct  301  LNAILGEVVAAESGYERVIETAMLPGTLMVNVHPLSIKRAAVNMVVNAARYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G E  R WFQVEDDGPGI PE+ +HL QPFVRGDSAR+ SGTGLGLAIVQRI+D+H+G+L
Sbjct  361  GRELLRGWFQVEDDGPGIEPERLQHLLQPFVRGDSARSTSGTGLGLAIVQRIIDSHDGVL  420

Query  421  ELGTSERGGLSIRAWLPVPV  440
            ++GTSERGGL IRA++P+PV
Sbjct  421  DIGTSERGGLLIRAYIPLPV  440


> UniRef100_W3V724 Signal transduction histidine kinase n=1 Tax=Photorhabdus 
temperata subsp. khanii NC19 RepID=W3V724_PHOTE
Length=443

 Score =  634 bits (1636),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 299/438 (68%), Positives = 364/438 (83%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+RLRFSPRS+F RTL L++ +LF SLVT+YLVV+NF I+PSLQQFNKVLAYEVR LM +
Sbjct  1    MKRLRFSPRSTFTRTLFLVMAMLFISLVTSYLVVVNFVIMPSLQQFNKVLAYEVRTLMAE  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +L+LEDG+ LV+ P  RREIY+ELGI+LYS   AE  GLRWA+HY+FLS +M+Q LGG  
Sbjct  61   RLKLEDGSFLVISPVVRREIYQELGIALYSESDAEIQGLRWARHYDFLSEKMSQYLGGKA  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            ++R+E+NK SP++WL ++L+P+IWVRVPLTEI Q  FSP+FRYTLAI+LL  G  WL+IR
Sbjct  121  DLRLEINKESPILWLNSYLAPDIWVRVPLTEIEQNQFSPIFRYTLAILLLTFGCIWLYIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
             QNRPL+++E+AA Q GKGI+ P +RE G+SEVR+  RAFN M+AG+K L  DRT+L+AG
Sbjct  181  FQNRPLLEMEYAARQTGKGIMMPTVREAGSSEVRASIRAFNQMSAGIKLLESDRTILIAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS++D YL+ESINKDIEECNAII QFIDYLRTGQEMPME  +
Sbjct  241  VSHDLRTPLTRIRLATEMMSKEDAYLSESINKDIEECNAIIAQFIDYLRTGQEMPMEFCE  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN++L EVI+AE+GYE++IE  L    I V  +P+SIKRA+ANM+VNA  YGNGWIKVSS
Sbjct  301  LNSILKEVISAENGYEQDIENNLSLPPITVNANPISIKRALANMLVNANHYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G     AWFQVEDDG GI PE    LFQPFVRG+ AR+ SGTGLGLAIVQRI+D H+G +
Sbjct  361  GQTHEFAWFQVEDDGAGIKPEDLPRLFQPFVRGERARSNSGTGLGLAIVQRIIDAHDGKI  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+GTS RGGLSIRA +PV
Sbjct  421  EIGTSPRGGLSIRACIPV  438


> UniRef100_T0QIB7 Osmolarity sensor protein n=1 Tax=Photorhabdus 
temperata subsp. temperata M1021 RepID=T0QIB7_PHOTE
Length=443

 Score =  633 bits (1632),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 298/438 (68%), Positives = 364/438 (83%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+RLRFSPRS+F RTL L++ +LF SLVT+YLVV+NF I+PSLQQFNKVLAYEVR LM +
Sbjct  1    MKRLRFSPRSTFTRTLFLVMAMLFISLVTSYLVVVNFVIMPSLQQFNKVLAYEVRTLMAE  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +L+LE+G+ LV+ P  RREIY+ELGI+LYS   AE  GLRWA+HY+FLS +M+Q LGG  
Sbjct  61   RLKLENGSFLVISPVVRREIYQELGITLYSESDAEIQGLRWARHYDFLSEKMSQYLGGKA  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            ++R+E+NK SP++WL ++L+P+IWVRVPLTEI Q  FSP+FRYTLAI+LL  G  WL+IR
Sbjct  121  DLRLEINKESPILWLNSYLAPDIWVRVPLTEIEQNQFSPIFRYTLAILLLTFGCIWLYIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
             QNRPL+++E+AA Q GKGI+ P +RE G+ EVR+  RAFN M+AG+K L  DRT+L+AG
Sbjct  181  FQNRPLLEMEYAARQTGKGIMMPTVREAGSLEVRASIRAFNQMSAGIKLLESDRTILIAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS++D YL+ESINKDIEECNAII QFIDYLRTGQEMPME  +
Sbjct  241  VSHDLRTPLTRIRLATEMMSKEDAYLSESINKDIEECNAIIAQFIDYLRTGQEMPMEFCE  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN++L EVI+AE+GYE++IE  L    I V  +P+SIKRA+ANM+VNA RYGNGWIKVSS
Sbjct  301  LNSILKEVISAENGYEQDIENNLSLPPITVNANPISIKRALANMLVNANRYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G     AWFQVEDDG GI PE    LFQPFVRG+ AR+ SGTGLGLAIVQRI+D H+G +
Sbjct  361  GQTHEFAWFQVEDDGAGIKPEDLPQLFQPFVRGERARSNSGTGLGLAIVQRIIDAHDGKI  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+GTS RGGLSIRA +PV
Sbjct  421  EIGTSPRGGLSIRACIPV  438


> UniRef100_U7R0P4 Osmolarity sensor protein n=1 Tax=Photorhabdus 
temperata J3 RepID=U7R0P4_PHOTE
Length=443

 Score =  632 bits (1629),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 297/438 (67%), Positives = 364/438 (83%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+RLRFSPRS+F RTL L++ +LF SLVT+YLVV+NF I+PSLQQFNKVLAYEVR LM +
Sbjct  1    MKRLRFSPRSTFTRTLFLVMAMLFISLVTSYLVVVNFVIMPSLQQFNKVLAYEVRTLMAE  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            +L+LE+G+ LV+ P  RREIY+ELGI+LYS   AE  GLRWA+HY+FLS +M+Q LGG  
Sbjct  61   RLKLENGSFLVISPVVRREIYQELGITLYSESDAEIQGLRWARHYDFLSEKMSQYLGGKA  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            ++R+E+NK SP++WL ++L+P+IWVRVPLTEI Q  FSP+FRYTLAI+LL  G  WL+IR
Sbjct  121  DLRLEINKESPILWLNSYLAPDIWVRVPLTEIEQNQFSPIFRYTLAILLLTFGCIWLYIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
             QNRPL+++E+AA Q GKGI+ P +RE G+ EVR+  RAFN M+AG+K L  DRT+L+AG
Sbjct  181  FQNRPLLEMEYAARQTGKGIMMPTVREAGSLEVRASIRAFNQMSAGIKLLESDRTILIAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS++D YL+ESINKDIEECNAII QFIDYLRTGQEMPME  +
Sbjct  241  VSHDLRTPLTRIRLATEMMSKEDAYLSESINKDIEECNAIIAQFIDYLRTGQEMPMEFCE  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN++L EVI+AE+GYE++IE  L    I V  +P+SIKRA+ANM+VNA RYGNGWI+VSS
Sbjct  301  LNSILKEVISAENGYEQDIENNLSLPPITVNANPISIKRALANMLVNANRYGNGWIRVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G     AWFQVEDDG GI PE    LFQPFVRG+ AR+ SGTGLGLAIVQRI+D H+G +
Sbjct  361  GQTHEFAWFQVEDDGAGIKPEDLPQLFQPFVRGERARSNSGTGLGLAIVQRIIDAHDGKI  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+GTS RGGLSIRA +PV
Sbjct  421  EIGTSPRGGLSIRACIPV  438


> UniRef100_C7BGS5 Osmolarity sensor protein EnvZ n=1 Tax=Photorhabdus 
asymbiotica subsp. asymbiotica (strain ATCC 43949 / 
3105-77) RepID=C7BGS5_PHOAA
Length=443

 Score =  629 bits (1622),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 296/438 (67%), Positives = 362/438 (82%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+ LRFSPRS+F RTL LI+ +LF SLV++YLVV+NF I+PSLQQFNKVLAYEVR LM +
Sbjct  1    MKLLRFSPRSTFTRTLFLIMAILFISLVSSYLVVVNFVIMPSLQQFNKVLAYEVRTLMAE  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KL+LEDG+ LV+ P  RREIY+ELGI+LYS   AE  GLRWA+HY+FLS +M+Q LGG  
Sbjct  61   KLKLEDGSFLVISPIVRREIYQELGITLYSESDAEMQGLRWARHYDFLSEKMSQYLGGEA  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            ++R+E++K +P++WL ++L+P+IWVRVPLTEI Q  FSP+FRY LAI+LL +G  WL+IR
Sbjct  121  DLRLEISKDTPILWLNSYLAPDIWVRVPLTEIEQNQFSPIFRYILAILLLTVGCIWLYIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
             QNRPL+++E+AA Q GKGI+ P +RE G+ EVR+  RAFN M+AG+K L  DRT+LMAG
Sbjct  181  FQNRPLLEMEYAARQTGKGIMMPAVREAGSQEVRASIRAFNQMSAGIKLLESDRTILMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS++D YL+ESINKDIEECNAIIEQFIDYLRTGQEMPME  +
Sbjct  241  VSHDLRTPLTRIRLATEMMSKEDAYLSESINKDIEECNAIIEQFIDYLRTGQEMPMEFCE  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN++L EVI+AE+GYE++IE  L    I V  +P+SIKRA+ANM+VNA RYGNGWIKVSS
Sbjct  301  LNSILKEVISAENGYEQDIENNLSLNPITVNANPISIKRALANMLVNANRYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G     AWFQVED+G GI  E    LFQPFVRG+ AR+ SGTGLGLAIVQRI+D H G +
Sbjct  361  GQTNKFAWFQVEDNGAGIKQEDLPRLFQPFVRGERARSNSGTGLGLAIVQRIIDAHEGKI  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+GTS RGGLSIRA +PV
Sbjct  421  EVGTSPRGGLSIRACIPV  438


> UniRef100_Q7N9U8 Osmolarity sensor protein n=1 Tax=Photorhabdus 
luminescens subsp. laumondii (strain TT01) RepID=Q7N9U8_PHOLL
Length=443

 Score =  617 bits (1592),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 293/438 (66%), Positives = 357/438 (81%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            MR LRFSPRS+F  TL LI+ +LF SLVT+YLVV+NF I+PSLQQFNKVLAYEVR LM +
Sbjct  1    MRLLRFSPRSTFTHTLFLIMAMLFISLVTSYLVVVNFVIMPSLQQFNKVLAYEVRTLMAE  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            KL+LEDG+ LV+ P  RREIY+ELGI+LYS   AE  GL WA+ Y+FLS +M + LGG  
Sbjct  61   KLKLEDGSFLVISPVVRREIYQELGITLYSESDAEIQGLCWARRYDFLSEKMGEYLGGKA  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            ++R+E+N  SP++WL ++L+P+IWVRVPLTEI Q  FSP+FRYTLAI+LL  G  WL+IR
Sbjct  121  DLRLEINTDSPILWLNSYLAPDIWVRVPLTEIEQNQFSPIFRYTLAILLLVFGCIWLYIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
             QNRPL+++E+AA Q GKGI+ P +RE G+ EVR+  RAFN M+AG+K L  DRT+L+AG
Sbjct  181  FQNRPLLEMEYAARQTGKGIMMPAVREAGSLEVRAAIRAFNQMSAGIKLLESDRTILIAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS++D YL+ESINKDIEECNAIIEQFIDYLRTGQEMPME  +
Sbjct  241  VSHDLRTPLTRIRLATEMMSKEDTYLSESINKDIEECNAIIEQFIDYLRTGQEMPMEFCE  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LN++L EVI+AE+GYE++IE  L    I V  +P+SIKRA+AN++VNA RYGNGWIKVSS
Sbjct  301  LNSILKEVISAENGYEQDIENHLSLHPITVNANPISIKRALANLLVNANRYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G     AWFQVED+G GI  E    LFQPFVRG+ AR+ SGTGLGLAIVQRI+D H+G +
Sbjct  361  GQTNKFAWFQVEDNGAGIKQEDLPRLFQPFVRGERARSSSGTGLGLAIVQRIIDAHDGKI  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+GTS RGGLSIR  +PV
Sbjct  421  EMGTSLRGGLSIRVCIPV  438


> UniRef100_K8WIT4 Osmolarity sensor protein n=1 Tax=Providencia 
rettgeri Dmel1 RepID=K8WIT4_PRORE
Length=443

 Score =  589 bits (1519),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 277/438 (63%), Positives = 347/438 (79%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+RLRFS RS+F+R+L L V LLFASLVT+Y+VVLNF ++PSLQQFNKVLAYEVR LMT+
Sbjct  1    MKRLRFSRRSTFSRSLFLFVALLFASLVTSYMVVLNFVVMPSLQQFNKVLAYEVRTLMTE  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            K+ L+DGT + V PA R++IY ELGI+ Y++ AA E GL WA+ Y+FLS  M++ +GG  
Sbjct  61   KMVLQDGTSVRVSPALRKKIYNELGITFYAHSAAMEEGLNWAKEYDFLSEHMSEYIGGKA  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
             V +E+ +  P++WL ++L+P+IWVRVPLTEI Q  FS +FRYTL I L    G WL+IR
Sbjct  121  SVHLELGREYPILWLTSYLAPDIWVRVPLTEIGQNQFSLVFRYTLTIFLTIFAGVWLYIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
             QN+PL++LE+ A +VGKG+I PP++E GA+EVR+  R+FNHMAAG+K L +DRT+LMAG
Sbjct  181  YQNKPLLELEYHAGEVGKGVILPPMQEKGATEVRAAIRSFNHMAAGIKTLENDRTVLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMMS +D YLAESINKDIEEC+AII QF+ YL+TGQEM ME  D
Sbjct  241  VSHDLRTPLTRIRLATEMMSPEDSYLAESINKDIEECDAIIGQFMSYLKTGQEMDMEFCD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+L + + +ES    EIETAL PGS+ V  +PL+IKRA+ NM+VNA RYGNGWIKVSS
Sbjct  301  LNAILMDAVNSESNVIGEIETALEPGSMIVNGNPLAIKRAITNMIVNAYRYGNGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G   +  WFQVEDDG GI  E    LFQPFV+G+ AR+  GTGLGLAI++RIVD H G +
Sbjct  361  GKTEDSVWFQVEDDGAGIKEEDIHRLFQPFVQGEKARSNKGTGLGLAIIRRIVDAHEGSI  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+  SERGG +IRA LP+
Sbjct  421  EIHKSERGGFAIRALLPL  438


> UniRef100_K8WI61 Osmolarity sensor protein n=1 Tax=Providencia 
burhodogranariea DSM 19968 RepID=K8WI61_9ENTR
Length=444

 Score =  583 bits (1503),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 273/438 (62%), Positives = 340/438 (77%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+RLRFS RS+F+R+L L V LLFASLVT+Y+VVLNF ++PSLQQFNKVLAYEVR LMT+
Sbjct  1    MKRLRFSRRSTFSRSLFLFVALLFASLVTSYMVVLNFVVMPSLQQFNKVLAYEVRTLMTE  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
             + L+DGT + V P  R++IY ELGI+ Y+  AA   GL WA+ Y+FLS  M + +GG  
Sbjct  61   NMVLQDGTTVRVSPELRKKIYNELGITFYAQSAAMAEGLNWAKEYDFLSENMTEYMGGEA  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
            +VR+E+ +  P++WL ++L+P+IWVRVPLTEI Q  FS +FRYTLAI L    G WL+IR
Sbjct  121  QVRLELGRDYPILWLTSYLAPDIWVRVPLTEIGQNQFSVVFRYTLAIFLAIFAGVWLYIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
             QN+PL++LE+ A QVGKG+I P ++E GA+EVR+  R+FNHMA G+K L +DRT+LMAG
Sbjct  181  YQNKPLLELEYHAGQVGKGVILPAMQEKGATEVRAAIRSFNHMATGIKTLENDRTILMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM   D YLAESINKDIEEC+AII QF+DYL+TGQEM ME  D
Sbjct  241  VSHDLRTPLTRIRLATEMMDPADSYLAESINKDIEECDAIIGQFMDYLKTGQEMTMEFCD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360
            LNA+L EV+ AE+    EIETA  PGSI V  +PL++KRA+ NM+ NA RYG GWIKVSS
Sbjct  301  LNAILNEVVTAETSVAGEIETAFEPGSIIVNANPLAVKRAITNMIENAHRYGGGWIKVSS  360

Query  361  GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML  420
            G      WFQVEDDG GI  E  + LFQPFV+G+ AR+  GTGLGLAI++RI+D H G +
Sbjct  361  GKSEEFVWFQVEDDGVGIKEEDIQRLFQPFVQGEKARSNKGTGLGLAIIRRIIDAHEGSI  420

Query  421  ELGTSERGGLSIRAWLPV  438
            E+  SERGG +IRA LP+
Sbjct  421  EIHKSERGGFAIRALLPL  438


> UniRef100_W3YJZ2 GHKL domain protein n=2 Tax=Providencia alcalifaciens 
RepID=W3YJZ2_9ENTR
Length=443

 Score =  582 bits (1501),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 272/438 (62%), Positives = 343/438 (78%), Gaps = 0/438 (0%)

Query  1    MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD  60
            M+RLRFS RS+F+R+L L V LLFASLVT+Y+VVLNF ++PSLQQFNKVLAYEVR LMT+
Sbjct  1    MKRLRFSRRSTFSRSLFLFVALLFASLVTSYMVVLNFVVMPSLQQFNKVLAYEVRTLMTE  60

Query  61   KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT  120
            K+ L+DGT + V PA R++IY ELGI+ Y++ AA E GL WA+ Y+FLS  M++ LGG  
Sbjct  61   KMVLQDGTSVRVSPALRKKIYNELGITFYAHSAAMEEGLNWAKEYDFLSENMSEYLGGKA  120

Query  121  EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR  180
             V +E+ +  P++WL ++L+P+IWVRVPLTEI Q  FS +FRYTL + L    G WL+IR
Sbjct  121  SVHLELGREYPILWLTSYLAPDIWVRVPLTEIGQNQFSQVFRYTLTVFLTIFAGVWLYIR  180

Query  181  IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG  240
             QN+PL++LE+ A +VGKG + PP++E GA+EVR+  R+FNHMAAG+K L +DRT+LMAG
Sbjct  181  YQNKPLLELEYHAGEVGKGHVMPPMQEKGATEVRAAIRSFNHMAAGIKSLENDRTVLMAG  240

Query  241  VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD  300
            VSHDLRTPLTRIRLATEMM  +DGYLAESINKDIEEC+AII QF+ YL+TGQEM ME  D
Sbjct  241  VSHDLRTPLTRIRLATEMMGPEDGYLAESINKDIEECDAIIGQFMSYLKTGQEMDMEFCD  300

Query  301  LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS  360